KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2392Help
Entry
TC41_2392         CDS       T01821                                 

Definition
(GenBank) diguanylate phosphodiesterase
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL
Motif
Other DBs
NCBI-ProteinID: AEJ44292
UniProt: F8IGL2
Position
complement(2274441..2275046)
Genome map
AA seq 201 aa AA seqDB search
MTLRKQSIVRIPGHELYGYELLLAHPKDTLGLMAEAGLLGDLDRYILETARSLARTERTR
IFVNATSELLSKQRLPFSECDDLSGVVLEITERSRLDMEAVAAYLAPFRARGLEVALDDF
GTGFNGLSRWGTLRPDYIKVALTNEMAHFFPLLRRAAEELEATIIAERVETPGQERWLRE
LGIGFGQGFLYGKPTPVVTAS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcggaagcaatcgattgtgcgcattccaggacacgaactgtatggatacgaa
ctgctattggcacaccccaaagacacgctgggcctgatggcggaggcgggacttctcggg
gatcttgaccgatacattctcgaaacggcgcgaagtctcgccaggacggagcgtacccgc
attttcgtcaacgcgacgtcggagcttctctcgaaacagcgcctgccgttttcagaatgc
gacgatctctcaggcgtcgtgctggagatcaccgagcgcagccgcctcgatatggaggcg
gttgctgcgtatttggccccgtttcgcgcgcgcgggctggaggtggcgctcgatgatttc
ggcaccggttttaacgggctgtcgcgctggggcacgctgcgcccggattacatcaaagtc
gccctgacgaacgagatggcgcacttttttcccttgttgcggcgcgcggcggaagagctt
gaagccaccatcatcgcggagcgcgtggagacgccggggcaggagcgttggctacgggaa
ctcgggatcgggttcggccagggatttctgtacgggaagccgacgcccgtggtgacggcc
tcatga

DBGET integrated database retrieval system