KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2394Help
Entry
TC41_2394         CDS       T01821                                 

Definition
(GenBank) Flp pilus assembly protein ATPase CpaE-like protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBP_BcsQ ParA CbiA MipZ AAA_31 GCD14 ArsA_ATPase CLP1_P NUDE_C
Motif
Other DBs
NCBI-ProteinID: AEJ44294
UniProt: F8IGL4
Position
complement(2276584..2277813)
Genome map
AA seq 409 aa AA seqDB search
MLALLCANGAEEILAQCEGILEVRLMTAMSELRKYAATGYVDGILVDARLGVTAAIRERL
PQIPVYEFTAPFDLAAVMRWEEQLRTQRSAPLDSSSVPETTVTKTSEPAPSVPTPPVSED
PPQPSVQPMAAPQVERPVTPTVSEPSVAPHNPVETLRHTTTPVVRRRTVPVLMLDSPKGG
AGRSTLGAHTAYYAALRGKRVAVIDLDVNGDIAQKFGFADAEDVRGWRGGSVEEAVRDGV
CLLHESGLHIFPSPQSPEVVLQSPDDAEYLVNLCLEEMDAVLLDMPQGWTPIHQAVLPYT
TKVMLVVNPAVDQLARIQEHADKLAFSGLDASGVSAFVNKSKRVRADERAMRQYLTPYTV
RAVVPFDPTIDKRGGLNGKRIVQAMKPFWDEVFEFSAVKAKRRWFGARA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgcttctttgtgcgaacggagcggaggagatcctggcgcagtgcgaggggatc
ttggaggttcggctcatgacagcgatgagcgagttacggaaatacgcggccacagggtat
gtggatgggatcttggtggacgcccggctgggtgtgaccgccgccatacgcgagcggttg
ccccagatcccggtgtatgaattcacggcgccgtttgatctggcggcggtcatgcgctgg
gaggagcaactgcgcacgcagaggagcgcgcccctggactcgtcatctgttccagagacg
acggtgacgaaaacttcggagcctgcgccctctgtgcctacgccgcccgtgtcggaggat
ccaccgcaaccgagtgtccaaccaatggccgctcctcaagtcgagcgtccggtgacgcca
accgtgtccgaaccgtctgtggcgcctcacaatccagtcgaaacgcttcggcacaccacg
acccccgtcgtgcgccgacgcaccgtgcccgtgctcatgctcgatagccccaagggtggc
gcggggcgctcgacgctcggcgcgcacaccgcgtattacgccgctttgcgcgggaagcgc
gtcgcggtgattgaccttgacgtcaacggcgacatcgcgcaaaagttcggctttgccgat
gccgaggatgtgcgcggttggcgcggcggatcggtggaggaggctgtgcgagatggggtg
tgtttattgcacgagtccggacttcacatcttcccgtcgccgcaaagccccgaagtggtg
cttcagtcaccggacgatgcggagtatctggtgaacctgtgcctcgaagagatggatgcg
gtactgcttgacatgccgcagggctggaccccgatccatcaggcggtgttgccgtatacc
acgaaagtcatgctggtggtcaaccccgccgtcgaccagttagccagaatccaggaacat
gcagacaaactcgcgttctcgggcctagacgcgtctggggtgtcggccttcgtcaacaag
tccaagcgtgtgcgtgcggatgaacgcgcgatgcggcagtatctgacgccctacactgtg
cgcgctgtggttccgtttgatcccacgatcgataaacgaggcggactgaacggcaaacgc
attgtgcaggcgatgaagccgttttgggatgaagtgtttgagttttcggcagtcaaagcc
aaacgccgttggttcggcgcgcgcgcttaa

DBGET integrated database retrieval system