KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2627Help
Entry
TC41_2627         CDS       T01821                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aad03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2485681..2486538)
Genome map
AA seq 285 aa AA seqDB search
MPELPEVETVRRHLAELIEGDVILDVAVRLSRIVRHPSPSLFVERLKDRSICRVERRGKY
LLFELDGVLLVSHLRMEGRYTVADPAEPELPHTHVVFRLASGRELRYADVRQFGTMDAVL
EGEPLPKGLAELGPEPFDPALCGAVLRHRWRGRRAPLKSLLLDQRQIAGLGNIYVDEALF
AAGLHPLTPAGAVGAETLDVLLREIRAVLARAIREGGSSVRSFRDGYGRHGGFQIQLAVY
GREGKPCPRCGGAIQKIKVAGRGTHVCPACQPISVAAPKGTGVNA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaattgcccgaggtggagactgtccgacgccatctcgcggagctcatcgagggg
gatgtgatcctcgacgtggcggtccgcctgtcgcgcatcgtgcgccatccttcgcctagc
ctttttgttgagcggctcaaggatcggagcatttgccgcgtggagcggcggggcaagtat
ttgttgttcgagttggatggcgtgcttctcgtctctcacctgcgcatggagggccgttac
accgtggcggatccggctgaaccggagcttccgcacacccatgtggtgtttcgcctcgcg
tcgggccgtgagttgcgttatgcggacgtgcgccagttcggcacgatggatgccgtcctc
gaaggcgagccgctgcccaaagggctggcggagcttggaccggagccgttcgatccggcg
ctctgcggcgcggttcttcgacatcgctggcggggtcgccgcgcccctctcaagagcctg
ctgctggatcagcggcagattgcagggctcggcaatatctacgtggatgaagcgctgttt
gccgcggggcttcacccactgacgcctgcgggggcagtgggcgcggaaacgcttgacgtc
ctccttcgcgagatccgcgctgtcctcgcgcgcgccatccgggagggcggatcgtcggtt
cgatcgtttcgcgacggctatggccggcatggcggttttcagattcaactggcggtctac
gggcgcgaaggcaagccctgtccgcgttgtggcggagcaattcagaagatcaaggtggcg
ggccgtggcacgcacgtgtgtccggcgtgtcagcccatctccgtcgccgcaccgaaagga
acgggggtgaacgcgtga

DBGET integrated database retrieval system