KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2683Help
Entry
TC41_2683         CDS       T01821                                 

Gene name
gatD
Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TC41_2683 (gatD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_2683 (gatD)
  Lipid metabolism
   00071 Fatty acid degradation
    TC41_2683 (gatD)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TC41_2683 (gatD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TC41_2683 (gatD)
   00626 Naphthalene degradation
    TC41_2683 (gatD)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TC41_2683 (gatD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2535328..2536353)
Genome map
AA seq 341 aa AA seqDB search
MRALVFDPEGGLRVAEVPTPQPGPGEVLIRVEACGICGSDRQLVRGEGAPFGTSYPVVLG
HEIAGRVEALGEGVSGLAPGDAVVVHPFVPCGQCAACARGEEHLCPHQGVLGFTRPGGDA
EYVAVPAQNAIRRPDGLDPAEAAILVDAYATPYRAMVSAGVAEEEAVLVIGTGGLGLAAL
QIAKALGVPQVAVLSRREDAGALALVSGADEFVTLADDSRQAARKLRRMAKGGVGLALDT
SGFADGIDFALDVLRPGGKLVTVAMPLDEIPVPFAKLARKGMSIMGSFGSRRADVEELLR
MAGEGRVQPDVVVGRRVSLDEAPDALGNPFFGRDTIVFHAP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcgtgtttgatccggaaggcggcctgcgcgtcgcggaggtgccgacgcca
cagcccgggcccggcgaggtcctcatccgcgtcgaggcgtgcggcatctgcggaagcgac
aggcaactggtccgcggcgagggcgcgccgtttgggacgtcgtatccagtggtgctgggc
cacgagattgcgggccgcgtggaggcgctcggcgagggcgtctcgggcctcgcgccgggc
gacgctgtggtggtgcacccatttgtgccgtgcggccagtgcgcggcgtgcgcgaggggc
gaggagcatctgtgcccgcaccagggggtgctcggcttcacgcggcccggcggcgacgcc
gagtacgtggcggtgccggcgcaaaacgccattcgccgcccggacgggctcgatccggcc
gaagcggccattctggtcgacgcgtacgcgacgccgtaccgggccatggtgtcggcgggg
gtggccgaggaagaggcggtgctcgtcatcggtacgggcgggctggggctcgcggcgctg
caaatcgccaaggccctgggcgtgccgcaggtggccgtgttgagccggcgagaggacgcg
ggggcgctcgcgctcgtctcgggcgcggacgagttcgttacgctcgcggacgattcgcgc
caggccgcgcgcaagctgcggcgcatggcgaaaggaggggtgggactggcgcttgacacg
tccggctttgccgacgggatagactttgctctcgacgtcctccgcccgggtggcaagctc
gtgaccgtggcgatgcctttggacgagatccccgtgccgttcgcgaagctcgcgcgcaaa
ggcatgtctatcatgggcagctttggctcgcgacgcgccgacgtcgaagagctcctccgg
atggctggggaggggcgcgttcagcccgacgtcgtggtggggcggcgcgtgtcgctcgat
gaggctccggacgctctgggtaacccgttttttggccgcgacacgattgtcttccatgcg
ccgtga

DBGET integrated database retrieval system