KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2767Help
Entry
TC41_2767         CDS       T01821                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TC41_2767
Enzymes [BR:aad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TC41_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2629419..2631032)
Genome map
AA seq 537 aa AA seqDB search
MPSRVSKSIFCNQVGYLTGGDKRFWIRAREAQPFALRTPEGQAVFAGMTKPVGGDWQAGN
FTALRVPGIYLLTVGPLEARIHVHRRAYRDVLEAMVRFFDYQLCGVALPEEEAGPWAHGP
CHTSDARVLGAEHAVACPGGWHDAGDYGKYTVPAAKAVADLLLAHEYFPGALAHVRPMRS
VHRAPHLPPALEVAREEIVWLLTMQDPATGGVYHKVTTPSFPRLDTRPEDDTAPLVLSPV
SYAATATFCAAMAHAALVYRAHDPTLASRCADAAQRAYAWLSEHEMRPFRNPAGILTGEY
GDRELRDELLWASSAMLRMTGDPGWARVCEPLLDLDLPWELGWADVALYGVMEYLRAPSA
AVSEDVRSRVKGRLLRELDALAAMAESHPFGIPMRDEDFIWGSNMVLLNRAMAFLLAEGV
GIPHPAARTVAQRSADYLLGANPLGQCYVTGFGQRPVRHPHHRPSAADDVDDPVPGMVVG
GPNRNLQDEIAHARLSGRPAMEAYLDHQDSYSTNEVAVYWNSPAVFVIAGLLEARER
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgcgcgtgtccaaatcgattttttgtaatcaagttgggtatctgaccggtggt
gacaagcgcttttggattcgggctcgcgaggctcagccgttcgcgctgcgcacgccggag
gggcaggccgtgttcgcggggatgacgaagcccgtcggcggggattggcaggccggcaat
ttcaccgcgcttcgagtgccggggatctacctcctgacggtggggcctctcgaggcgcga
atccatgtgcatcgccgcgcgtatcgcgacgtgctcgaagccatggtgcgattcttcgac
tatcagctctgcggcgtcgcgctgccagaagaggaagcaggtccatgggcgcatggtccg
tgccatacgagcgacgccagggtgttgggcgcggagcacgccgtggcctgcccgggcggt
tggcacgacgctggcgattacggcaaatacacggttcccgccgccaaggccgtcgcggat
cttcttctcgctcacgagtacttcccgggggcgcttgcgcacgtccgccccatgcgctcg
gtgcaccgggcgcctcacctgccgccggcgctcgaggtggcgcgcgaggagattgtctgg
ctgctcaccatgcaggatccggcgacaggcggcgtataccataaagtcactacgccttcc
tttccgcggctcgacacccgccccgaagacgacactgccccgctcgtcctcagccctgtc
tcttacgcggcaacggccacattttgcgccgccatggcgcacgccgccctggtgtaccgc
gcccacgatccgactctcgcctcgcgctgcgcagacgctgcgcaacgcgcgtatgcgtgg
ctcagcgaacacgaaatgcggccgtttcgcaatcccgcgggaatcctcacaggcgaatac
ggcgacagagaactccgcgacgagttgttgtgggcgtccagcgccatgcttcgcatgacc
ggtgatcccgggtgggcacgcgtgtgcgagcccctgcttgatctcgacctcccctgggag
ctgggatgggcggacgtggcgctctacggcgtaatggaatacctgcgcgcgcccagcgcc
gccgtgtcggaagacgtgcgaagccgggtgaaaggtcggcttctccgagagctcgacgcg
ctcgccgccatggccgaatcgcatcccttcggcattcccatgcgggacgaggatttcatt
tggggcagcaatatggtgctcttgaaccgcgccatggcgtttttgttggccgaaggcgtc
gggatccctcatcccgcggcgcgaacggtggcccagcgctcggcagactacctgcttggc
gccaatccgctcggtcagtgctacgtcacgggctttggccaacgccccgtgcgtcatccc
catcatcgcccctcggctgcggatgatgtggacgatcccgttccaggcatggtggtggga
ggcccaaaccggaacctgcaggacgagatcgcccacgcgcgactttcggggaggcccgcg
atggaggcgtacctcgatcatcaggacagctactcgaccaacgaggtcgccgtctattgg
aattcacctgccgtgtttgtcatcgcaggtttgcttgaagcgcgcgagaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system