KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_3133Help
Entry
TC41_3133         CDS       T01821                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aad00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2950809..2951696)
Genome map
AA seq 295 aa AA seqDB search
MTFSFDVEKPFPLAYSGNVFIGATEDFAAAKAVIYGMPMDWTVSFRAGARLGPARIREVS
LGLEEYSPYLDRDLSEIAYFDAGDIPLPFGNPEESLERIYQYVSALYAADKLPIGLGGEH
LVSWGSIRAAAERYPDLRVIHIDAHTDLRDHYEGEPLSHATVIKKVCDLIGPDRVYQFGI
RSGTREEFRWAREHTHFAPFELAEPLLAVLPELHGKPVYITWDIDVFDPATAPGTGTAEH
GGIFAPEAFRAITYMKALRVVGFDLVEVAPQIDPTEQTQILAAKIVREALLAFVR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgttctcgtttgatgtggagaagccttttccgctcgcctacagcggcaatgtgttc
atcggcgccacggaggatttcgccgccgccaaggcggtcatctacggcatgcccatggac
tggaccgtgtcgtttcgggccggggcgcgcttaggtcccgctcgcatccgcgaagtgagc
ctcgggctcgaggagtacagcccgtatctcgatcgcgacctgagcgagatcgcctatttt
gacgcgggggacattccgcttccgttcggcaatccggaggagagcctggaacgtatctat
cagtacgtgtcggcgctctacgccgcggacaagctgccgataggcctcggcggtgagcac
ctggtctcgtggggatccatccgcgcggcggcggagcgctacccggatctgcgcgtcatc
cacatcgacgcacacaccgatctgcgcgatcactacgagggcgaaccgctctctcacgcc
accgtcattaagaaggtgtgcgatctcatcgggccggatcgcgtgtaccagttcggcatc
cgcagcggcacgcgcgaggagttccgctgggcgcgcgagcacactcacttcgcgccgttt
gagctcgccgaaccgctcctcgccgtgctgccggagttgcacgggaagccggtgtacatc
acctgggacatcgacgtgttcgatccggccacggctccgggcacgggcacggcggagcac
ggcggcatctttgcgcccgaggcgttccgcgccatcacgtacatgaaggctctgcgcgtc
gtcggcttcgatctcgtcgaggtggcgcctcagatcgatccgacggagcagacgcagatc
ctcgcggcgaaaatcgtgcgcgaggccctgctcgcgtttgtgcggtga

DBGET integrated database retrieval system