KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_3163Help
Entry
TC41_3163         CDS       T01821                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aad00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2977805..2978425
Genome map
AA seq 206 aa AA seqDB search
MATFHVNARQVQLQHQAKSVDTARIEQAVRMILEAIGEAPDREGLVDTPARVARMYQEIF
SGLHQDPRDELSARFHVEHGEVVLVRDIPFYSMCEHHLLPFFGIAHIAYLPHNHVVTGLS
KLARLVDVVAKKPQVQERMTNEIADALVEALEAEGVLVVVDAEHLCMSMRGIRKPGSRTT
TVATRGRYLHHPHEREEVLRLIRLGG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgttccacgtcaatgcaaggcaggtgcagcttcagcatcaggcgaaatccgtc
gatactgcacggattgaacaggcggttcggatgattctcgaagcgattggagaggcgccg
gatcgagagggcctcgtcgacacgcccgcgcgtgtcgcccgaatgtaccaagaaatcttt
tcgggattgcatcaagaccctcgggacgagttgtccgctcgctttcacgtggaacacggc
gaggtcgtgctggtgcgggacatccccttctattcgatgtgcgaacaccacctgctcccg
ttcttcggaatcgcgcacatcgcatacctcccgcacaaccatgtggtgacgggcctgtcc
aagctggcgcggctcgtcgacgtcgtggcgaagaagccgcaggtccaagagcgcatgacg
aacgagatcgcggacgcgctggtggaggcactcgaggccgaaggcgttctggtggtcgtg
gatgccgaacacctgtgcatgagcatgcgcggcattcgcaaacctgggagccgcacaacc
accgtggcgacccgcggccgttacctgcatcatcctcacgagcgcgaggaagtgctccgg
ctcatccgtctcgggggttga

DBGET integrated database retrieval system