KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_3240Help
Entry
TC41_3240         CDS       T01821                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00330  Arginine and proline metabolism
aad00332  Carbapenem biosynthesis
aad01100  Metabolic pathways
aad01130  Biosynthesis of antibiotics
aad01230  Biosynthesis of amino acids
Module
aad_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TC41_3240 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TC41_3240 (proB)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TC41_3240 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEJ45119
UniProt: F8IDS6
Position
complement(3051094..3052191)
Genome map
AA seq 365 aa AA seqDB search
MVVKIGSSSLTEADGSLALSRMRQMVSDVARLGRETGCQFVLVSSGAIAAGLGRLGWQRA
HISMPEKQAAAAVGQVLLMEHYERLFAEHGIAVGQILMTRADVEDRKRFVNIRNTVMALL
QRGVMPIINENDTVAVEEIRFGDNDTLAALVALVAEADTLVLLTDIDGLYTANPRQDPSA
TRIAEVEVITDEIERIAGGAGSSAGTGGMRTKIAAAKIATQSGVEVVIAHRDEPRVLERV
LAGEPVGTRFLASREPVSLRKSWLLHAPKPEGALQVDHGAMRALIAGGKSLLLPGLVQVH
GEFQEGAVVELVGPTGAAFGKGISNFSSRDLAEWLEKKRAGEDVHALHEVVHRNDMVIWT
EATAG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgaagattgggtcgagctcactcaccgaggcggacggatcgctcgcactgtcg
cggatgcggcagatggtgtctgacgtggcgcggctcgggcgggagacggggtgccagttc
gtgctggtctcttcgggcgccatcgcggcggggctcgggcggctcggctggcagcgcgcg
cacatctcgatgccggagaagcaggcggctgcggcggtgggccaggtcctcctcatggag
cactacgagcggctgtttgccgagcacggcatcgcggtggggcagatcctcatgacgcgc
gcggacgtggaggatcggaagcggtttgtgaacatccgcaacacggtcatggctctgctc
cagcgcggcgtgatgcccatcatcaacgagaacgacaccgtggcggtggaggaaatccgc
ttcggcgacaacgacacgctggcggcgctcgtcgcgctcgtcgcggaggcggacacgttg
gtgctgctcaccgacatcgacgggctgtacacggccaacccgcgccaggatcctagcgca
acccggattgcggaggtggaggtcatcacagacgagatcgagcgcatcgcgggtggggcg
ggatcgagcgcgggcacgggcgggatgcggacgaagattgcggcggcgaagattgccacg
cagtcgggcgtcgaggtcgtcattgcgcaccgggacgagccgcgggtgctcgagcgggtg
ctcgccggggagccggtgggcacgcggtttctggcgtcgcgggagccggtcagcctgcgc
aagtcttggctcttgcacgcgccgaagccggaaggcgccctgcaggtggatcacggcgcc
atgcgcgcgctcatcgcgggcggcaagagcctgctcttgcccggcctcgtgcaggtgcat
ggcgagtttcaggagggcgccgtggtggaactcgtcgggcccaccggcgcggcattcggc
aagggcatctcgaacttctcctcgcgcgatctcgccgagtggctcgagaaaaagcgcgca
ggcgaggacgtgcacgcgctgcacgaagtcgtgcaccgaaatgacatggtgatctggacg
gaggcgacggcgggatga

DBGET integrated database retrieval system