KEGG   Aquifex aeolicus: aq_090Help
Entry
aq_090            CDS       T00013                                 

Definition
(RefSeq) hypothetical protein
Organism
aae  Aquifex aeolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
55975..56379
Genome map
AA seq 134 aa AA seqDB search
MEDRMAYKFLSEDWIKAYAEEWNKNEKLMNDLKNFSASIKYYVEGKENDAVELIIEKGKA
VSAGKADPNKRYDFELWASLENWKKLATGEMGPRAAMLTKRLKFKGSMITAMKYMGAFEE
SLKMMGRVPTVWDV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ttggaggatagaatggcttacaagtttctttcagaagactggataaaggcgtacgcagag
gagtggaacaaaaacgaaaagttaatgaacgacctcaaaaacttctcggcgagtataaag
tactacgtggaaggtaaagaaaatgacgcagtggagctgataattgaaaagggaaaggct
gtttccgcaggaaaggctgaccctaataaaaggtacgactttgaactctgggcaagtctt
gagaactggaaaaagctcgcaacgggggagatgggccccagagccgcgatgctcacaaag
aggttaaagtttaagggttctatgattacagctatgaagtacatgggagcctttgaagag
agcttaaagatgatgggcagagttccgacggtctgggatgtttaa

DBGET integrated database retrieval system