KEGG   Aquifex aeolicus: aq_091mHelp
Entry
aq_091m           CDS       T00013                                 

Definition
(RefSeq) ATPase AAA
Organism
aae  Aquifex aeolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56372..57964
Genome map
AA seq 530 aa AA seqDB search
MFKFINKVDFKTFDEIFDGVLVIDKNRRIVFANKKAKEILGEVKEGESCRGLFSICEHCP
MELVEDSEQGVQVYDVLTKRKNHVCLSMSPLFEGGEFTGVLEVFRDVSKVIHYMEEVKRQ
KEFVEVVLDSIVEAVLVLDEKGNVINHNGNASKVLCSRFESITGKNLKEITSLSLEDLPP
EGERADIYIETPCGRQKASVLLSKLKQGKGWVLSLYIVPEIFAGEGNKLKIVTKSPKFLK
VLEKVKTISEMNVNVLITGETGTGKSLLARYIHYLSPRRDKPFVKINCGAIPENLLEAXL
FGYNKGAFTGAIASKPGKVEMANGGTLFLDEIGELPLHLQVKLLGLIQDKEFERIGDLKP
RKADVRIIAATNKNLKKLVEEGKFREDLYYRLNVVNVELPPLRERKEDIPHLVSYFLEKF
SKIHGKKVKGVSPEAMKLLLEYDYPGNVRELENAIEHAVVVSSTSLIGPDDLPEEIRIGS
KVKKKFRENEELEKIKEALERAGGNKSLAAKLLGIHRTTLWRKLKEYGLA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttataaacaaggtggattttaaaacatttgacgaaatttttgacggtgtt
ctcgtaatagataaaaacaggaggatagtttttgctaacaaaaaggcaaaagaaatactg
ggggaggtaaaggagggagagtcctgcagggggcttttttccatttgtgaacactgccct
atggaacttgttgaggactcagagcaaggagttcaggtttacgacgtcctgacgaaaagg
aaaaatcacgtgtgcctcagtatgagtcccctctttgagggaggggaatttacaggagtc
cttgaagttttcagggatgtgagcaaggtaatccactacatggaagaggttaaaagacaa
aaggagtttgtagaagtcgtacttgactctatcgtggaggctgttctcgttctggacgaa
aaagggaacgttataaaccacaacgggaacgcaagcaaagttctttgttccaggtttgaa
agcatcacaggaaaaaatctgaaggaaataacttctctgagtctggaagacctcccgccg
gaaggagaaagggcggacatttacatagaaactccctgcggtaggcaaaaagcctccgtt
ctcctctcaaaactgaagcagggaaagggctgggttctttctctatacatagttcccgag
atattcgcaggtgagggaaacaagttaaaaatcgttacaaagagtccaaagtttctgaag
gttctggaaaaggtaaaaacgatttccgagatgaatgtaaacgttttgatcactggagag
acgggaacgggaaagagcctgctcgccagatatatacactacctctctcccaggagggac
aagcccttcgtgaagataaactgcggtgctattcctgaaaacttacttgaggcgtagctc
tttggctacaacaagggagcttttacaggagcaattgcgagtaaacccggaaaggtagaa
atggcaaacggcggaacactttttctggatgagataggagaacttccgctacaccttcag
gtaaagctcctcggattgattcaggacaaggagtttgaaaggataggagatctaaaaccg
agaaaggcggacgttaggattatcgcggctactaataaaaacctcaaaaaactggtagaa
gaagggaaattcagggaggacctttattacaggttgaacgtcgtgaacgtggaattacca
ccactcagggagaggaaggaggatatacctcaccttgtgagttacttcctcgagaaattt
tcaaagatccacgggaagaaggttaagggagtatctcccgaagccatgaaactgctctta
gagtacgattatccgggaaacgtgagggaacttgaaaacgcaattgaacacgctgttgtg
gtctcaagcacgagtttaataggacccgacgacctgcctgaagagataagaatcggaagc
aaagttaagaagaagttcagggagaacgaggaactggagaagataaaagaagccttggaa
agggctgggggaaacaaaagccttgcggcaaagctcttgggtatccacaggaccactctg
tggaggaagttaaaggaatacgggcttgcttag

DBGET integrated database retrieval system