KEGG   Aquifex aeolicus: aq_1134Help
Entry
aq_1134           CDS       T00013                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aae  Aquifex aeolicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aae01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aae00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(793767..794837)
Genome map
AA seq 356 aa AA seqDB search
MRIVFKIGSNLLETDEGDIDLSFLSKLAEGIKKLHSFGDKVLIVSSGAVLSGAKKLGIKE
KPKDLTLKQALASVGQSYLMHLYDTIFSNYGLKVGQVLLTKDVFSKEKEERFKNAKSTLE
KLLELGVVPVINENDAVAVEELVFGDNDFLAVYVSFMVNADLLVIFSSAGGLKDDKDRII
PVVEDIEKVFKYVRGTGTSFGTGGMRSKLEATRLATTLNIPVIITSKEENILDLRNLKTK
GTLFKPSKRKLRNALKVIATLEEPKGIIVVDRGAQEALKAGKSLLPAGVVSVQGNFKRGD
VVSIQNEEGLIIGKGKVNFSSEEIEKIKGLKTSEVRKLLNTTKDEVIHRDNMVIFL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagttttcaagataggttctaacctccttgagaccgacgagggagatatagac
ctcagctttttatccaagctggcggaaggcataaaaaaactccactcctttggtgataaa
gttttaatagtctcttcgggtgcggttctctcgggagcgaagaagctaggaattaaggaa
aagccaaaagatctgactttaaaacaggccctcgcctccgtgggacagagctacctcatg
cacctttacgacacgatattctcaaactacggattgaaggtaggtcaggttctcctcacg
aaagacgttttttcaaaggaaaaggaagagaggtttaaaaacgcaaagagcacccttgaa
aagctcctagaactgggcgtagttcccgtaataaacgagaacgacgccgttgcagtggag
gaactcgtgttcggggacaacgacttcctcgcggtttacgtctctttcatggtaaacgct
gaccttctagtgatattctcaagtgctggtggactgaaggacgacaaagacaggataatt
cccgtggttgaggacatagaaaaggttttcaagtacgtgaggggaacgggtacgagcttc
ggaacgggcggaatgaggagcaagcttgaggccacaagactcgcaacaactctgaacatt
cccgtgataataacgagcaaggaagaaaacattttggacttgaggaatttgaaaactaag
ggaacgctttttaagccatccaagagaaaactcaggaacgccctcaaggttatagctacc
ttggaagaaccgaaaggtataatcgtggtggacaggggagctcaagaagccctgaaagca
ggaaagagcctgcttcccgcgggtgtggtttccgttcagggaaactttaaaaggggagat
gtggtaagcattcagaacgaagaaggactgataataggaaagggaaaggtgaatttttct
tcggaggaaatagaaaagataaaaggtctaaaaacgagtgaagttagaaaactattaaac
acaacaaaagacgaagtaatccacagagataatatggttatttttctctga

DBGET integrated database retrieval system