KEGG   Aquifex aeolicus: aq_1167Help
Entry
aq_1167           CDS       T00013                                 

Gene name
forA2
Definition
ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_1167 (forA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1167 (forA2)
   00020 Citrate cycle (TCA cycle)
    aq_1167 (forA2)
   00620 Pyruvate metabolism
    aq_1167 (forA2)
   00640 Propanoate metabolism
    aq_1167 (forA2)
   00650 Butanoate metabolism
    aq_1167 (forA2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1167 (forA2)
   00680 Methane metabolism
    aq_1167 (forA2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    aq_1167 (forA2)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     aq_1167 (forA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
819763..820932
Genome map
AA seq 389 aa AA seqDB search
MPEQRVVEPDYLLLEAPREKKFITGSQAFAEAVKRANVDVAIAYPITPQSETMHLVGDLY
AQGYVKDYYRAEEEYGAMSAIAGAVRGGARAFTATSGPGLLRGLEAIVSWPGHRIPAVLG
VMTRVVNAPLSIQPDNVEISYLLNSGLVVLHAENQQDVFDFTLAGFVISEKVDVYLPVVV
ATEGFFVTHAKGYVELPPEDMKLPPRDPYKAPVPPTDCEIPPARIQRDAPVQKSNFMSYL
IHAVWQQEVWSANRRAAKWIKHYLGGLIEVVNPDAEVFVVASGCAAAQGREAQRYATMEG
LNVGLIKVKSLRPFPVDEIREALKNAKAVIVPEHNIVGWLAKEVKAAIPNSGIVVDGPRV
YGGMTLPVELIMEEIYKAFGIKKEKKVVV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcaaagagttgttgagcctgactaccttcttttagaggctccaagggagaaa
aaatttattaccggatctcaggcttttgcagaagctgtaaagagggctaacgtagacgtc
gctatagcttaccccataactccccaatccgaaaccatgcacctagtcggtgacctttac
gcacaaggatacgttaaggattactatagagcggaagaagagtacggtgctatgtccgca
atagcgggagcggtgagaggaggagcaagagcctttaccgcaacatcgggtccaggactt
ctgagaggtcttgaggctatagtttcatggcctggacacagaattcccgcagttctcggt
gtaatgaccagagtcgtaaacgcacccctctccatacagcccgacaacgttgaaatatcc
tacttacttaactcaggactcgtagttctccacgctgaaaaccagcaggacgtttttgac
tttacactggcaggtttcgtgatctccgaaaaagtagacgtttacctgccggtcgtagtt
gcaacggaaggtttcttcgtaactcacgcaaaaggttacgtagaactcccacctgaagat
atgaaactcccaccgagagatccttacaaagcaccggtaccgcccaccgactgtgaaata
cctcctgcgagaatacagagagacgctccggttcagaagtcaaacttcatgagctacctt
atacacgctgtatggcagcaggaagtttggtccgcaaacaggagagctgcaaagtggatt
aagcactacctcggtggactcatagaagttgtaaacccagacgcggaagtgttcgtagta
gcttccggatgtgcagccgcacagggtagggaagctcaaaggtacgctactatggaaggc
ctaaacgtaggtctaataaaggtaaaatccctcagaccgttccccgtggacgaaataagg
gaagctctcaagaacgcaaaagccgtaatagttcccgagcacaacatagttggatggctc
gcaaaagaagtaaaagctgctatacccaacagcggaatagttgttgacggtccgagagtt
tacggaggaatgaccctacccgttgaacttataatggaagaaatttacaaagccttcggt
attaagaaggaaaagaaggttgttgtttaa

DBGET integrated database retrieval system