KEGG   Aquifex aeolicus: aq_1168Help
Entry
aq_1168           CDS       T00013                                 

Gene name
forB2
Definition
ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_1168 (forB2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1168 (forB2)
   00020 Citrate cycle (TCA cycle)
    aq_1168 (forB2)
   00620 Pyruvate metabolism
    aq_1168 (forB2)
   00640 Propanoate metabolism
    aq_1168 (forB2)
   00650 Butanoate metabolism
    aq_1168 (forB2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1168 (forB2)
   00680 Methane metabolism
    aq_1168 (forB2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    aq_1168 (forB2)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     aq_1168 (forB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820956..821825
Genome map
AA seq 289 aa AA seqDB search
MGLEYVRISPGFEKYMPRDYVDLVKYGPFGRKVDVMDMGQFKELVEEHPMCAGCYMAYFI
RVFYTALPNPEDTIVIGTAGCARLALSQAAVPFIYGNYGDTNAVASGLKRALSIRFPDKH
KDVVVIAGDGGLIDIGFGMTMHSWFRREKFTTIMVDNEVYGNTGGQESGMSPKGVQLKMA
PLGKKFDKINAVELAKTAGCVYVARISPTNPKRIAKTIRRAILAARHFGPTFIHAYTSCN
IEYSIPTREVLADARKREKQDFKFYEWMTDEVKEFLEEVERKEKQEVKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggaatacgtaagaatttctccaggatttgaaaaatacatgcccagagactac
gtggatctcgttaagtacgggcccttcggaagaaaagtagacgtaatggatatgggccaa
ttcaaggaactcgttgaagaacaccccatgtgcgctggatgctacatggcttacttcata
agggtgttctacacggcactccccaatcccgaggacacaatagtaatcggaacggcggga
tgtgcaaggctcgcactctcacaagctgcagttcccttcatctacggtaactacggtgac
acgaacgcagttgcatctggtctaaagagggcactttctataaggttccccgacaaacac
aaggacgttgtagttatagcaggtgacggtggtctcatagacatcggttttggtatgacg
atgcactcctggttcagaagggaaaagttcactaccataatggttgacaacgaagtttac
ggaaacactggcggacaggaaagcggaatgtctcccaaaggcgttcaactcaagatggct
cctttaggaaagaagttcgataagataaacgccgttgaacttgcaaagactgctggatgt
gtttacgttgcaagaatttctcccacaaaccccaagagaatagctaagaccataagaagg
gcgatacttgccgcaagacactttggtcctaccttcatccacgcgtacacctcctgtaac
atagagtactccatacccacgagagaagttctcgcagacgcaaggaagagggaaaagcag
gacttcaagttctacgaatggatgacggacgaagttaaggaattccttgaagaagttgaa
aggaaggaaaagcaggaggttaagaaatga

DBGET integrated database retrieval system