KEGG   Aquifex aeolicus: aq_1200Help
Entry
aq_1200           CDS       T00013                                 

Gene name
forG1
Definition
ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aae01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aae00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aae00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aae00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aae00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aae00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:aae00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:aae00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:aae00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
843356..844081
Genome map
AA seq 241 aa AA seqDB search
MTQPVRRRINVRMPAIGGQGAVSAAHIMATAADHAGYYAVSNPFYGAEKRMAPSESYVRI
GIEPIYDRGEVVYPDVIMVFHSQVITMGKSYTMPFYSGIKKNGLIIINAEEDLLSDEDKA
FLEERNVKIFNFSATKFAVEIAGTELATNMAMIGAFFGITQIVGMESIEEGIKARFLKKF
VASGGTASLDSAIERKFKKKLELIEKNIATARAAYEFANQWAKEQGIEPWLPKPEAVLQR
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacccgttagaagaaggattaacgttagaatgcccgctatcggtgggcagggt
gcggtttccgccgcccacattatggctaccgctgcggaccacgcagggtattacgcagtc
tccaaccccttctacggtgcagaaaagagaatggcaccctctgaaagttacgtgaggata
gggatagaacctatatacgacaggggagaagtcgtttatcccgacgttataatggtcttc
cactctcaggttataaccatgggtaaatcctacacaatgcccttctactcaggtataaag
aagaacggactcatcataataaacgcagaagaggatcttctttctgacgaagacaaggct
ttccttgaagagagaaacgtaaagatatttaacttctccgccacgaagtttgcagttgag
atcgcgggaacggaactcgccacaaacatggctatgataggagcattcttcggaattact
caaatagttggaatggagtccattgaagaaggtattaaggctaggttccttaaaaaattc
gttgcgtccggtggtactgcatctctggactcggctattgagagaaagttcaagaaaaag
ttagaactcatagaaaagaacatagctaccgcaagagcggcttacgagtttgccaatcag
tgggcaaaagaacaaggaatagaaccctggcttcccaagcctgaagctgttctccagagg
gcttaa

DBGET integrated database retrieval system