KEGG   Aquifex aeolicus: aq_1221Help
Entry
aq_1221           CDS       T00013                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
aae  Aquifex aeolicus
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aae00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:aae00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859084..860505
Genome map
AA seq 473 aa AA seqDB search
MSKVKTRFAPSPTGYLHLGNARTAIFSYLFARHNNGGFVLRIEDTDPERSKKEYEEMLIE
DLKWLGIDWDEFYRQSERFDIYREYVNKLLESGHAYPCFCTPEELEKEREEARKKGIPYR
YSGKCRHLTPEEVEKFKKEGKPFAIRFKVPENRTVVFEDLIKGHIAINTDDFGDFVIVRS
DGSPTYNFVVVVDDALMGITHVIRGEDHIPNTPKQILIYEALGFPVPKFAHLPVILGEDR
SKLSKRHGAVSVRAYREEGYMPEALFNYLCLLGWSPPEEGREIFSKEELIKIFDLKDVND
SPAVFNKEKLKWMNGVYIREVLPLDVLLERAIPFLEKAGYDTSDREYIKKVLEYTRDSFD
TLSEMVDRLRPFFVDEFEIPEELWSFLDDEKAYQVLSAFLEKIREKKPETPQEVKKLAKE
IQKALKVKPPQVWKPLRIALTGELEGVGIDILIAVLPKEKIEKRILRVLEKLS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtgaaaacgaggttcgcacccagtccaaccggatacctacacctcggaaac
gcaagaacagccatattcagttatctgtttgcaaggcacaacaacggaggttttgtactt
cgtatagaggacaccgatccagagcgttcaaagaaagagtatgaagaaatgctgatagag
gatttaaagtggctcggtatagattgggacgaattctacagacagtccgagaggtttgac
atatacagggagtacgtgaacaagctccttgagagcggtcacgcttacccgtgtttttgc
acgccggaagaacttgaaaaagaaagagaagaggctagaaagaagggaattccttacagg
tattctggaaagtgcagacacctgacaccagaagaggtggagaagttcaagaaggaggga
aaacccttcgccataaggtttaaagttcccgaaaacagaaccgtggtgtttgaagaccta
ataaagggtcacatagccattaacacggatgacttcggggactttgtaattgtcaggagc
gatggctcacccacttacaacttcgtcgttgttgttgacgacgcccttatgggaattacc
cacgtgataagaggagaggaccacatacccaacactcccaagcaaatactcatatacgaa
gctctcgggtttcccgttcccaagttcgcacaccttcccgttatactgggagaggacagg
agtaaactctcaaagaggcacggagctgtttcggtaagggcttacagggaagaaggctat
atgccggaagccctcttcaattacctctgtctcttagggtggtcccctccagaagaggga
agggagatattctcaaaggaagaactgataaagatttttgacctcaaagacgtaaacgac
tccccggcggtcttcaacaaggaaaaactaaagtggatgaacggagtgtacataagggag
gtgcttcccttagacgttctccttgaaagggctattcccttcttggaaaaagcgggctac
gacacgagcgacagggagtatataaagaaagttctcgaatacacgcgcgactcctttgat
acattgagcgaaatggtagacaggctcagacccttcttcgtggacgagtttgaaatacca
gaagagctctggagcttcctagacgacgaaaaggcttatcaggttctctcagctttcttg
gaaaaaatcagggagaaaaaacccgaaactccccaggaagtaaagaagctcgcaaaggaa
atacaaaaagccctgaaagtaaaaccaccgcaggtatggaaacccctcaggatagccctc
acgggtgaactcgaaggtgtgggcatagacatactcatagccgttcttcctaaggaaaaa
atagaaaagaggatactgagggttctggaaaagctctcgtga

DBGET integrated database retrieval system