KEGG   Aquifex aeolicus: aq_1221Help
Entry
aq_1221           CDS       T00013                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
aae  Aquifex aeolicus
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    aq_1221 (gltX)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    aq_1221 (gltX)
Enzymes [BR:aae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     aq_1221 (gltX)
Amino acid related enzymes [BR:aae01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   aq_1221 (gltX)
Transfer RNA biogenesis [BR:aae03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    aq_1221 (gltX)
 Prokaryotic Type
   Other AARSs
    aq_1221 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859084..860505
Genome map
AA seq 473 aa AA seqDB search
MSKVKTRFAPSPTGYLHLGNARTAIFSYLFARHNNGGFVLRIEDTDPERSKKEYEEMLIE
DLKWLGIDWDEFYRQSERFDIYREYVNKLLESGHAYPCFCTPEELEKEREEARKKGIPYR
YSGKCRHLTPEEVEKFKKEGKPFAIRFKVPENRTVVFEDLIKGHIAINTDDFGDFVIVRS
DGSPTYNFVVVVDDALMGITHVIRGEDHIPNTPKQILIYEALGFPVPKFAHLPVILGEDR
SKLSKRHGAVSVRAYREEGYMPEALFNYLCLLGWSPPEEGREIFSKEELIKIFDLKDVND
SPAVFNKEKLKWMNGVYIREVLPLDVLLERAIPFLEKAGYDTSDREYIKKVLEYTRDSFD
TLSEMVDRLRPFFVDEFEIPEELWSFLDDEKAYQVLSAFLEKIREKKPETPQEVKKLAKE
IQKALKVKPPQVWKPLRIALTGELEGVGIDILIAVLPKEKIEKRILRVLEKLS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtgaaaacgaggttcgcacccagtccaaccggatacctacacctcggaaac
gcaagaacagccatattcagttatctgtttgcaaggcacaacaacggaggttttgtactt
cgtatagaggacaccgatccagagcgttcaaagaaagagtatgaagaaatgctgatagag
gatttaaagtggctcggtatagattgggacgaattctacagacagtccgagaggtttgac
atatacagggagtacgtgaacaagctccttgagagcggtcacgcttacccgtgtttttgc
acgccggaagaacttgaaaaagaaagagaagaggctagaaagaagggaattccttacagg
tattctggaaagtgcagacacctgacaccagaagaggtggagaagttcaagaaggaggga
aaacccttcgccataaggtttaaagttcccgaaaacagaaccgtggtgtttgaagaccta
ataaagggtcacatagccattaacacggatgacttcggggactttgtaattgtcaggagc
gatggctcacccacttacaacttcgtcgttgttgttgacgacgcccttatgggaattacc
cacgtgataagaggagaggaccacatacccaacactcccaagcaaatactcatatacgaa
gctctcgggtttcccgttcccaagttcgcacaccttcccgttatactgggagaggacagg
agtaaactctcaaagaggcacggagctgtttcggtaagggcttacagggaagaaggctat
atgccggaagccctcttcaattacctctgtctcttagggtggtcccctccagaagaggga
agggagatattctcaaaggaagaactgataaagatttttgacctcaaagacgtaaacgac
tccccggcggtcttcaacaaggaaaaactaaagtggatgaacggagtgtacataagggag
gtgcttcccttagacgttctccttgaaagggctattcccttcttggaaaaagcgggctac
gacacgagcgacagggagtatataaagaaagttctcgaatacacgcgcgactcctttgat
acattgagcgaaatggtagacaggctcagacccttcttcgtggacgagtttgaaatacca
gaagagctctggagcttcctagacgacgaaaaggcttatcaggttctctcagctttcttg
gaaaaaatcagggagaaaaaacccgaaactccccaggaagtaaagaagctcgcaaaggaa
atacaaaaagccctgaaagtaaaaccaccgcaggtatggaaacccctcaggatagccctc
acgggtgaactcgaaggtgtgggcatagacatactcatagccgttcttcctaaggaaaaa
atagaaaagaggatactgagggttctggaaaagctctcgtga

DBGET integrated database retrieval system