KEGG   Aquifex aeolicus: aq_1240Help
Entry
aq_1240           CDS       T00013                                 

Gene name
adh2
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    aq_1240 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1240 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    aq_1240 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    aq_1240 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    aq_1240 (adh2)
   00626 Naphthalene degradation
    aq_1240 (adh2)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     aq_1240 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874528..875253)
Genome map
AA seq 241 aa AA seqDB search
MKLFITGIGSGLGKALVEEGIKRGYEVYALSRHLPEEFKEKIHFVKCDLLKVEEVQGCLF
KLLSGVKELELAILNAGILGKFSDMKDISLHEIDEVMKVNLWSNKVIIDTLMELGIKVKT
LIGISSGAARNCNRGWNAYSLSKAGLNCLLKLYSWELPETKVISLAPGLVLTPMLKEVMS
QNEEKYPSIKRIKNAPKLTPEKTAEFIFSILPKLESVESGSFVDVRDFPEYEEYILRYGV
Y
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttcataacgggaataggctcagggctgggaaaggcactcgtagaggaagga
ataaagaggggctacgaggtttacgctttaagcagacacctgcccgaggaattcaaggag
aagatacactttgtaaagtgcgaccttttaaaggtagaagaagttcaaggctgtcttttt
aaactccttagtggtgtaaaagaactggaacttgcaatcctgaacgcgggaatcctcgga
aagttttccgatatgaaggacataagcctacacgaaatagacgaagtgatgaaggtaaac
ctgtggtccaacaaggtaataatagacacgcttatggaactcggaataaaggtaaaaact
ttaataggtatttcttcgggggctgcgaggaactgcaacaggggttggaacgcctactcc
ctttcaaaggcggggctaaactgcctcttaaaactctactcctgggaactccccgaaact
aaagtaatttccttggctccaggacttgtgctcacacctatgctgaaagaggtaatgtcg
cagaatgaggaaaagtacccgtccataaagaggataaagaacgctcctaaactcacacct
gaaaagactgcggagtttatattttccattcttccgaaactggagagtgtagagtcgggc
tcctttgtggacgtccgagactttcccgagtacgaggagtacattttaaggtacggagtt
tactga

DBGET integrated database retrieval system