KEGG   Aquifex aeolicus: aq_1240Help
Entry
aq_1240           CDS       T00013                                 

Gene name
adh2
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
aae  Aquifex aeolicus
Pathway
aae00010  Glycolysis / Gluconeogenesis
aae00071  Fatty acid degradation
aae00350  Tyrosine metabolism
aae00625  Chloroalkane and chloroalkene degradation
aae00626  Naphthalene degradation
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1240 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    aq_1240 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    aq_1240 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    aq_1240 (adh2)
   00626 Naphthalene degradation
    aq_1240 (adh2)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     aq_1240 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase IF2_N KR RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 1192631
NCBI-ProteinID: NP_213849
UniProt: O67285
Position
complement(874528..875253)
Genome map
AA seq 241 aa AA seqDB search
MKLFITGIGSGLGKALVEEGIKRGYEVYALSRHLPEEFKEKIHFVKCDLLKVEEVQGCLF
KLLSGVKELELAILNAGILGKFSDMKDISLHEIDEVMKVNLWSNKVIIDTLMELGIKVKT
LIGISSGAARNCNRGWNAYSLSKAGLNCLLKLYSWELPETKVISLAPGLVLTPMLKEVMS
QNEEKYPSIKRIKNAPKLTPEKTAEFIFSILPKLESVESGSFVDVRDFPEYEEYILRYGV
Y
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttcataacgggaataggctcagggctgggaaaggcactcgtagaggaagga
ataaagaggggctacgaggtttacgctttaagcagacacctgcccgaggaattcaaggag
aagatacactttgtaaagtgcgaccttttaaaggtagaagaagttcaaggctgtcttttt
aaactccttagtggtgtaaaagaactggaacttgcaatcctgaacgcgggaatcctcgga
aagttttccgatatgaaggacataagcctacacgaaatagacgaagtgatgaaggtaaac
ctgtggtccaacaaggtaataatagacacgcttatggaactcggaataaaggtaaaaact
ttaataggtatttcttcgggggctgcgaggaactgcaacaggggttggaacgcctactcc
ctttcaaaggcggggctaaactgcctcttaaaactctactcctgggaactccccgaaact
aaagtaatttccttggctccaggacttgtgctcacacctatgctgaaagaggtaatgtcg
cagaatgaggaaaagtacccgtccataaagaggataaagaacgctcctaaactcacacct
gaaaagactgcggagtttatattttccattcttccgaaactggagagtgtagagtcgggc
tcctttgtggacgtccgagactttcccgagtacgaggagtacattttaaggtacggagtt
tactga

DBGET integrated database retrieval system