KEGG   Aquifex aeolicus: aq_1281Help
Entry
aq_1281           CDS       T00013                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
aae  Aquifex aeolicus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aae00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aae00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
906163..907440
Genome map
AA seq 425 aa AA seqDB search
MKNTTLYTYRDYFVIRGGKPLTGKVKISGAKNAALPIMFATILTEEPCTITNVPDLLDVR
NTLLLLRELGAELEFLNNTVFINPSINSFITNQEIIRRMRASVLSLGPLLGRFGRAVVGL
PGGCSIGARPIDQHLKFFKEAGADVEVREGYVYVNLKEKRRVHFKFDLVTVTGTENALLY
LASVPEESILENIALEPEVMDLIEVLKKMGAHVKVEGRSAYVKGSENLKGFTHSVIPDRI
EAGTFMVGAVLTDGEILLENARINHLRAVVEKLKLIGGEVVEENGNLRVFRKESLRACDI
ETQVYPGFPTDMQAQFMALLSVAKGKSRIKENIFEHRFHHAQELNRLGANITVRGNTAYV
EGVERLYGSEVYSTDLRASASLVLAGLVAQGETVVRDVYHLDRGYEKLEEKLKKLGADIE
RVSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaccacattatatacttaccgtgattacttcgttataaggggaggaaagccc
cttaccgggaaggtaaaaatttcgggggcaaagaacgctgccctccccattatgtttgca
acgatccttacggaagaaccctgcaccattacaaacgttccggatctccttgatgtaaga
aatactctacttttgcttcgggaacttggagcagagcttgagtttttaaacaacaccgtt
tttataaatccatctattaactcctttattacaaatcaggaaatcataaggcgcatgcgt
gcttccgttttgagccttggtccccttctcgggagatttggaagggcggtcgttggactt
cccggcggttgttctataggagcgagaccaatagaccagcacctgaagtttttcaaagaa
gctggtgcagatgtagaggtcagggaggggtacgtatacgtaaacttgaaggaaaagagg
agagttcactttaaatttgacctcgttaccgtcacgggaactgaaaacgcactactttat
ctggcaagcgttcccgaagagagcatccttgaaaatattgccttagaacccgaagtaatg
gatttaatagaagtcttgaagaaaatgggagcacatgtaaaagttgaagggaggagtgct
tacgtaaaaggttctgaaaacttgaaagggtttactcactcggttattcccgacaggata
gaggctggcacttttatggtcggggctgtgctaacggacggagaaatccttctggaaaac
gcgagaataaatcacctcagagcggttgtagagaagttaaaacttatcggaggagaggtt
gtggaagaaaacgggaacttgagggtattcaggaaggaaagtttaagggcttgtgatata
gaaactcaggtttacccgggatttcccacggatatgcaggcccagttcatggcactcctt
tcggtagcaaaggggaaatcaaggataaaggaaaacatctttgaacacaggtttcaccac
gctcaggaactgaacaggctcggggcaaacataaccgtgaggggaaacacagcctacgtt
gagggggtagaaaggctctacggaagtgaggtttactcaacagacctcagggcttccgca
tctctcgtgctcgcgggtttggtcgcccaaggggaaaccgtggtgagggacgtttaccac
cttgacaggggttatgaaaaacttgaagaaaagttaaagaaactcggagccgacatagaa
agggtaagtgaattatga

DBGET integrated database retrieval system