KEGG   Aquifex aeolicus: aq_136Help
Entry
aq_136            CDS       T00013                                 

Gene name
cpx
Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aae  Aquifex aeolicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84354..85421
Genome map
AA seq 355 aa AA seqDB search
MRKGLLLMAVFAGFVVAKEKIDDKELLKMARQYFKPLPKVAENPQNPVTPEKVKLGKMLY
YDPRLSKSGLISCNTCHNLARYGVDNLPTSIGHRWAIGPRNAPTVYNAAIHIAQFWDGRA
KDVEEQALGPIVNPIEMANTEENAVKTLKSIPEYVELFKKAFPNEKDPVKYENIGKAIGA
FERTLMTPSRFDEFLKGNTKALTEQEKRGLKTFIEVGCVACHNGPGVGGNMFAKFGMITE
YWKVTYPYVLVGKPAIKVDFGRFGVTKKEEDMFVFKVPSLRNIEHTYPYFHDGSVWSLED
AVRIMAKTQLGKELTDQQVKDIVAFLKALTGKIPKHALEVPELPPSTDKTPKPEL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggtttactcctaatggcggtattcgcaggctttgtggtggcaaaggaaaag
attgacgacaaggaactccttaaaatggcaaggcagtacttcaaacccctccccaaagtt
gcggaaaatccccaaaatcctgttaccccagagaaggtaaagctcggaaagatgctctac
tacgatcccagactttcaaagagcggactaatcagctgtaacacctgtcacaacctcgcg
aggtacggagttgataacctcccgacttccataggacacaggtgggctattggaccaaga
aacgcacccacggtttacaacgccgcaatccacatagctcagttctgggacggaagggct
aaggacgttgaagagcaggctctcggacccatagtaaacccaatagaaatggcaaatacc
gaagaaaacgccgtaaagactttaaaatccatacccgaatacgtagaactcttcaaaaaa
gcgttccccaacgaaaaggatcccgttaagtacgaaaacataggaaaggcaataggtgcc
tttgaaagaactcttatgactccctcaaggtttgacgaattcctgaaaggaaacacgaaa
gctctaacagaacaagaaaagagaggactcaagacattcatagaagtggggtgtgtggct
tgccacaacggaccaggtgtaggcggaaacatgtttgctaagttcggaatgattaccgag
tactggaaagttacttatccttacgttctcgtaggaaaacctgcgataaaggttgacttc
ggtaggttcggtgtgacgaagaaagaagaagacatgttcgtattcaaagttccttccctc
aggaacatagaacacacgtacccctacttccacgacggaagcgtgtggagccttgaagac
gctgtaaggataatggcaaaaactcagctaggaaaagaactcacggaccagcaggttaaa
gatatagttgccttcctcaaagccctaaccggtaagataccaaagcacgcacttgaagtt
cccgaactacccccgtccacagacaaaaccccgaaacccgaactttaa

DBGET integrated database retrieval system