KEGG   Aquifex aeolicus: aq_1401Help
Entry
aq_1401           CDS       T00013                                 

Gene name
celY
Definition
endoglucanase fragment
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aae  Aquifex aeolicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    aq_1401 (celY)
Enzymes [BR:aae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     aq_1401 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995597..996574
Genome map
AA seq 325 aa AA seqDB search
MKFFTVLLFFLSFVFSASIDVWKLWEHYKKTFISKEGYVVDPYNNYRVTSEAQGYTLLIS
ALIGDKETFYRVWNWTKENLKRKDNLFSWLWINGHVVDRNNATDADLFIAYALLIASQKW
KDYTLLSEAKRIKDSVKELVVPVCNGRRDYLFIPAKEGYIKNNIVSLNVVYYVPFIFRKF
YESFGEDVWKNLYRYTYDIYTIRNISTHLTYDLFKKELRKGNFIDIDGMRFLIYAYVDDK
RSLLYMRNAVEGILKFYREKGYIPLKYNYVTGGASKLKAPFCFYYVFSKLLPSDKNLEKE
FRNGLEYDKKNYYCYALLLIALLHD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttctttactgttcttttgtttttcctttcattcgttttttcggcgagtattgac
gtgtggaaattgtgggaacattataaaaagacctttataagtaaagaggggtacgtggta
gatccttacaacaattacagggttacttcggaagctcaaggctatacacttctcatatcc
gccctcataggggataaggaaaccttctacagggtatggaactggacaaaggaaaatctc
aaaaggaaggataatttattctcctggctctggataaacggacacgtagttgacagaaac
aacgcaacggacgccgacctgttcatagcttacgctctgctaatcgcttctcaaaagtgg
aaggattatacgctcctgagcgaggcaaagaggataaaggattccgtcaaggaactcgtt
gtgcccgtgtgcaacggaagaagggattacctttttatacccgcaaaggaaggttacatt
aaaaacaatatagtgagtttaaacgtagtctactacgtcccattcatcttcagaaagttc
tacgaatctttcggagaggacgtgtggaaaaacctctataggtacacctacgacatttat
acgattaggaatatatcaacgcaccttacatacgacctattcaaaaaggaattgagaaag
gggaattttatagacatagacggcatgcgtttcctgatatacgcttacgtggacgacaaa
aggagtctcctttacatgaggaacgcagtagagggtattctgaagttttacagagaaaag
ggttacattcctttgaagtataattacgtaaccggtggagcaagcaagttaaaagctccc
ttttgtttttactacgtattcagtaagctccttccttccgataaaaacttagaaaaggag
ttcagaaatgggcttgagtacgacaagaagaattactactgttacgctctgcttcttatt
gctctcctacacgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system