KEGG   Aquifex aeolicus: aq_1468Help
Entry
aq_1468           CDS       T00013                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aae  Aquifex aeolicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    aq_1468 (folP)
Enzymes [BR:aae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     aq_1468 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1045240..1046439)
Genome map
AA seq 399 aa AA seqDB search
MLLIKHFEDKDLFYKFLKEKIGVFFREAEQRAFEGIFHCVYFSDPSIPPNALFESARKSC
VSIFHKDGRTVVCGSEAKLKDFCSELVKYPEAKKLAQEILESFIRYRKKYFQLNYNQKIL
PLGLKTAIMGVLNVTPDSFSDGGEFLEPKKAVERAVKMAQEGAEIIDIGGESTRPGSKRI
SAEEELNRVLPALKEVRRELPDTWISVDTYKAEVAKACLDEGADIINDVSGGTFDPEILK
VVTEYRCPYVINHMKGRPETWKEEPIIYEDVVEEISQFFKNQINKLKELGFREEEKIILD
PGIGFGKLPEHNVEILKRFHEFKIFGKILMVGVSRKSFIGLILEGFLNRKTEPKERLFGS
LGALAPAVLGGASIVRVHDVKETREFLALLDAVRTYDVS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaatcaaacactttgaggataaggacctcttttacaaatttctgaaagagaaa
atcggcgtattttttagagaggctgagcagagggcttttgagggtatttttcactgcgtt
tacttttccgatccctctattcctccgaatgccttatttgaatctgcaaggaagagttgt
gtttccatttttcacaaggacggaagaaccgtagtttgcggaagtgaagcgaagctaaag
gacttttgttcggaactcgtaaaataccctgaggctaagaagctcgctcaggaaatactt
gagagttttataaggtacagaaaaaagtactttcaattaaattacaatcagaaaatactt
ccgctggggctaaaaaccgcgataatgggagttttaaacgttacgcctgacagcttttcc
gacggaggagagttcttagaaccaaagaaagcggttgaaagggctgtaaagatggcacag
gagggagcggagattatagacatagggggagagagcacgagaccgggctcaaaaaggata
agtgctgaggaagaactaaatagagttttacccgctttaaaggaagtgagaagagaactt
cctgacacatggatttccgtggacacttacaaggcggaggttgcaaaggcttgccttgac
gagggagcggacataataaacgatgtgagcggtgggacgtttgacccggaaatactgaaa
gttgttacagagtacaggtgcccttacgttataaaccacatgaagggaagacccgaaacg
tggaaggaagagcccataatttacgaggacgtggtggaagaaatttcacaattttttaaa
aatcagataaataaattaaaggagttaggttttagagaagaggaaaaaattattcttgat
ccaggcataggcttcggcaaactgcccgagcacaacgttgaaatactcaagcgctttcac
gaatttaaaattttcggaaaaatactcatggttggagtatcgagaaagtcttttatagga
ttgattttagaagggttcttaaacaggaagacggagccaaaggaaaggctatttggaagt
ctcggagctcttgctcccgcggttctgggaggtgctagcatagtaagggttcacgacgtt
aaggaaacgagggaatttttagctctgcttgacgctgtgaggacgtatgacgtttcttga

DBGET integrated database retrieval system