KEGG   Aquifex aeolicus: aq_1548Help
Entry
aq_1548           CDS       T00013                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aae  Aquifex aeolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    aq_1548 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    aq_1548 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    aq_1548 (trpA)
Enzymes [BR:aae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     aq_1548 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1096848..1097636)
Genome map
AA seq 262 aa AA seqDB search
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVAD
GPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSRE
KGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVT
GTTGAREKLPYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKL
AGQKKIEDLGNLVKELKEGLRE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaataagcgataagtttacagaattaaaggaaaaaagagaaaaagcccttgtt
tcttacctcatggtgggttatccagactacgaaacttctcttaaggccttcaaagaagtt
ttaaaaaacggaacggacatactggaaataggatttcccttttcggatcctgtggcggac
ggccctacaattcaggtagcccatgaggttgccctcaaaaacgggatacgatttgaagac
gttctggaactctccgaaacactgagaaaagaatttccggacattccctttctattgatg
acttactacaaccctatattcaggatagggcttgaaaagttctgcaggctttcaagggaa
aagggaatagacggttttattgttcccgatctaccgccagaagaagcggaagaactaaaa
gcggtgatgaagaagtacgtactctccttcgttcccttgggtgctcccacgagtacccga
aagcgtataaagctaatatgcgaagctgcggatgagatgacctactttgtttccgttact
ggaaccacaggggcaagggaaaaactcccatacgaaaggataaagaaaaaggtagaggag
tacagggagttgtgcgataagcctgtggtggtgggctttggagtttctaaaaaagaacat
gccagagaaataggttcctttgctgacggagtggtcgtgggaagtgctctcgtaaaatta
gcaggacaaaagaaaatagaggatttaggaaacttggtgaaggaactcaaggaaggatta
agagaatga

DBGET integrated database retrieval system