KEGG   Aquifex aeolicus: aq_162Help
Entry
aq_162            CDS       T00013                                 

Gene name
folK
Definition
folate biosynthesis 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aae  Aquifex aeolicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    aq_162 (folK)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     aq_162 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98536..99018
Genome map
AA seq 160 aa AA seqDB search
MATVYLGLGSNVGDRISYILKAIEKLEEFLEIEKISTVYESKAWGFENQGNFLNFVLKAK
TSLLPQELLLKIKKVEKEVGRKERFKWGPREIDIDILLYKDEVIRTKLLKVPHPFLEKRD
FFVYPLLEIEPNVIHPIYRKPLKEFKPENTLKPFCCILKV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctacagtctatttaggactcgggagcaacgtaggagataggatatcttacatactt
aaagcgatagaaaaacttgaggaatttttggaaatagaaaaaatatccacagtctacgaa
agcaaagcctggggttttgaaaaccaaggaaactttctaaatttcgttttaaaggcaaag
acttctcttctcccgcaggaacttcttttgaagataaaaaaagtggaaaaggaagttgga
cgaaaggaaaggtttaagtggggcccgagggaaatagacatagatatactcctgtacaaa
gatgaagtcatcaggaccaaactcctgaaagtcccccatccctttctggaaaaaagggat
tttttcgtctatccactacttgaaatagaaccgaatgtaatacatcctatctacagaaag
cctctgaaggagtttaagcccgaaaatacactgaaacctttctgctgtatcttaaaagta
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system