KEGG   Aquifex aeolicus: aq_162Help
Entry
aq_162            CDS       T00013                                 

Gene name
folK
Definition
folate biosynthesis 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aae  Aquifex aeolicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98536..99018
Genome map
AA seq 160 aa AA seqDB search
MATVYLGLGSNVGDRISYILKAIEKLEEFLEIEKISTVYESKAWGFENQGNFLNFVLKAK
TSLLPQELLLKIKKVEKEVGRKERFKWGPREIDIDILLYKDEVIRTKLLKVPHPFLEKRD
FFVYPLLEIEPNVIHPIYRKPLKEFKPENTLKPFCCILKV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctacagtctatttaggactcgggagcaacgtaggagataggatatcttacatactt
aaagcgatagaaaaacttgaggaatttttggaaatagaaaaaatatccacagtctacgaa
agcaaagcctggggttttgaaaaccaaggaaactttctaaatttcgttttaaaggcaaag
acttctcttctcccgcaggaacttcttttgaagataaaaaaagtggaaaaggaagttgga
cgaaaggaaaggtttaagtggggcccgagggaaatagacatagatatactcctgtacaaa
gatgaagtcatcaggaccaaactcctgaaagtcccccatccctttctggaaaaaagggat
tttttcgtctatccactacttgaaatagaaccgaatgtaatacatcctatctacagaaag
cctctgaaggagtttaagcccgaaaatacactgaaacctttctgctgtatcttaaaagta
tga

DBGET integrated database retrieval system