KEGG   Aquifex aeolicus: aq_1620Help
Entry
aq_1620           CDS       T00013                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aae  Aquifex aeolicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_1620 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    aq_1620 (sucC)
   00640 Propanoate metabolism
    aq_1620 (sucC)
   00660 C5-Branched dibasic acid metabolism
    aq_1620 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1620 (sucC)
Enzymes [BR:aae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     aq_1620 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137329..1138486
Genome map
AA seq 385 aa AA seqDB search
MKLHEHQAKEIFAKYGIPVPEGKVAFSLKEAKEVAEELGEFPLVVKAQIHCGGRGKAGGV
KIVKDMDELEKAVESLLGKVLKTFQCPDGKPVNRVLIEKATNIDKEYYLAITLDRSKSKP
VIMASAAGGMEIEEIVKENPEAIIIETIDPELGLMPYQARELAFKLNLPVKEFASIALKL
YQIYSDLDASLVEINPLVLTKEGNLIALDAKLDIDDNALFRHKDLEEMEDETQLPQLEVE
AKKYGLNYIKLNGNIGCMVNGAGLAMATMDIIKLAGGEPANFLDVGGGANVEQIANAFRI
LMADPDVKAVFINIFGGILRVDRLAQGLIEASKMVELRVPIVARLEGTNVEEGKRMLQES
GLNFIIAEDMWDGAKKAVEIANKQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaacatcaggcaaaggagatatttgcaaaatacggaattcccgttccg
gaaggcaaggtggcattttccctgaaggaagcaaaagaagtcgcagaagaactcggagaa
tttcctctcgttgtaaaggctcagattcactgcggtggtaggggtaaagcaggcggagtg
aagatagtcaaggacatggacgagctggaaaaggcagttgaatcactcctcggtaaggtt
ctaaaaacctttcagtgtcccgacggaaaacccgtaaacagggtactcatagaaaaggct
acgaacatagacaaggagtactatcttgctataactttggaccgttcaaagtccaagccc
gttataatggcttccgcagcgggcggtatggaaattgaagaaatagtcaaagaaaatcca
gaggcgataataatcgaaacaatagacccagaactgggacttatgccctatcaggcgagg
gagcttgcctttaagttgaacctgcccgtaaaggaattcgcaagcatagccctgaaactt
taccagatatattccgaccttgacgcttcactcgttgagataaatcccctcgttctcaca
aaggaaggaaaccttatagcccttgacgcaaaactcgacatagacgacaacgccctcttc
aggcacaaggaccttgaagagatggaagacgaaacacaacttccacaacttgaggtggaa
gccaagaagtacggccttaactacataaaactcaatggaaatataggttgtatggttaac
ggtgcggggctcgctatggcgactatggacataatcaagctcgcgggaggagaacccgcg
aacttccttgacgtgggtggtggcgcgaacgtagagcaaatcgcgaacgccttcagaata
ctcatggcggacccggacgtgaaggcggtcttcataaatatattcggtggaatactgagg
gtggacaggctggctcagggactcatagaagcctccaaaatggtagaactcagagttccc
attgttgcgagacttgaaggaacgaacgttgaagaaggaaagaggatgctccaagagagt
ggactcaacttcataatagcggaagacatgtgggacggagcgaaaaaggctgtggaaata
gcgaataaacaaagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system