KEGG   Aquifex aeolicus: aq_1620Help
Entry
aq_1620           CDS       T00013                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aae  Aquifex aeolicus
Pathway
aae00020  Citrate cycle (TCA cycle)
aae00640  Propanoate metabolism
aae00660  C5-Branched dibasic acid metabolism
aae00720  Carbon fixation pathways in prokaryotes
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    aq_1620 (sucC)
   00640 Propanoate metabolism
    aq_1620 (sucC)
   00660 C5-Branched dibasic acid metabolism
    aq_1620 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1620 (sucC)
Enzymes [BR:aae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     aq_1620 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Succ_CoA_lig DUF3182
Motif
Other DBs
NCBI-GeneID: 1193169
NCBI-ProteinID: NP_214111
UniProt: O67546
Position
1137329..1138486
Genome map
AA seq 385 aa AA seqDB search
MKLHEHQAKEIFAKYGIPVPEGKVAFSLKEAKEVAEELGEFPLVVKAQIHCGGRGKAGGV
KIVKDMDELEKAVESLLGKVLKTFQCPDGKPVNRVLIEKATNIDKEYYLAITLDRSKSKP
VIMASAAGGMEIEEIVKENPEAIIIETIDPELGLMPYQARELAFKLNLPVKEFASIALKL
YQIYSDLDASLVEINPLVLTKEGNLIALDAKLDIDDNALFRHKDLEEMEDETQLPQLEVE
AKKYGLNYIKLNGNIGCMVNGAGLAMATMDIIKLAGGEPANFLDVGGGANVEQIANAFRI
LMADPDVKAVFINIFGGILRVDRLAQGLIEASKMVELRVPIVARLEGTNVEEGKRMLQES
GLNFIIAEDMWDGAKKAVEIANKQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaacatcaggcaaaggagatatttgcaaaatacggaattcccgttccg
gaaggcaaggtggcattttccctgaaggaagcaaaagaagtcgcagaagaactcggagaa
tttcctctcgttgtaaaggctcagattcactgcggtggtaggggtaaagcaggcggagtg
aagatagtcaaggacatggacgagctggaaaaggcagttgaatcactcctcggtaaggtt
ctaaaaacctttcagtgtcccgacggaaaacccgtaaacagggtactcatagaaaaggct
acgaacatagacaaggagtactatcttgctataactttggaccgttcaaagtccaagccc
gttataatggcttccgcagcgggcggtatggaaattgaagaaatagtcaaagaaaatcca
gaggcgataataatcgaaacaatagacccagaactgggacttatgccctatcaggcgagg
gagcttgcctttaagttgaacctgcccgtaaaggaattcgcaagcatagccctgaaactt
taccagatatattccgaccttgacgcttcactcgttgagataaatcccctcgttctcaca
aaggaaggaaaccttatagcccttgacgcaaaactcgacatagacgacaacgccctcttc
aggcacaaggaccttgaagagatggaagacgaaacacaacttccacaacttgaggtggaa
gccaagaagtacggccttaactacataaaactcaatggaaatataggttgtatggttaac
ggtgcggggctcgctatggcgactatggacataatcaagctcgcgggaggagaacccgcg
aacttccttgacgtgggtggtggcgcgaacgtagagcaaatcgcgaacgccttcagaata
ctcatggcggacccggacgtgaaggcggtcttcataaatatattcggtggaatactgagg
gtggacaggctggctcagggactcatagaagcctccaaaatggtagaactcagagttccc
attgttgcgagacttgaaggaacgaacgttgaagaaggaaagaggatgctccaagagagt
ggactcaacttcataatagcggaagacatgtgggacggagcgaaaaaggctgtggaaata
gcgaataaacaaagctaa

DBGET integrated database retrieval system