KEGG   Aquifex aeolicus: aq_1620Help
Entry
aq_1620           CDS       T00013                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aae  Aquifex aeolicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aae01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aae00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aae00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:aae00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:aae00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137329..1138486
Genome map
AA seq 385 aa AA seqDB search
MKLHEHQAKEIFAKYGIPVPEGKVAFSLKEAKEVAEELGEFPLVVKAQIHCGGRGKAGGV
KIVKDMDELEKAVESLLGKVLKTFQCPDGKPVNRVLIEKATNIDKEYYLAITLDRSKSKP
VIMASAAGGMEIEEIVKENPEAIIIETIDPELGLMPYQARELAFKLNLPVKEFASIALKL
YQIYSDLDASLVEINPLVLTKEGNLIALDAKLDIDDNALFRHKDLEEMEDETQLPQLEVE
AKKYGLNYIKLNGNIGCMVNGAGLAMATMDIIKLAGGEPANFLDVGGGANVEQIANAFRI
LMADPDVKAVFINIFGGILRVDRLAQGLIEASKMVELRVPIVARLEGTNVEEGKRMLQES
GLNFIIAEDMWDGAKKAVEIANKQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaacatcaggcaaaggagatatttgcaaaatacggaattcccgttccg
gaaggcaaggtggcattttccctgaaggaagcaaaagaagtcgcagaagaactcggagaa
tttcctctcgttgtaaaggctcagattcactgcggtggtaggggtaaagcaggcggagtg
aagatagtcaaggacatggacgagctggaaaaggcagttgaatcactcctcggtaaggtt
ctaaaaacctttcagtgtcccgacggaaaacccgtaaacagggtactcatagaaaaggct
acgaacatagacaaggagtactatcttgctataactttggaccgttcaaagtccaagccc
gttataatggcttccgcagcgggcggtatggaaattgaagaaatagtcaaagaaaatcca
gaggcgataataatcgaaacaatagacccagaactgggacttatgccctatcaggcgagg
gagcttgcctttaagttgaacctgcccgtaaaggaattcgcaagcatagccctgaaactt
taccagatatattccgaccttgacgcttcactcgttgagataaatcccctcgttctcaca
aaggaaggaaaccttatagcccttgacgcaaaactcgacatagacgacaacgccctcttc
aggcacaaggaccttgaagagatggaagacgaaacacaacttccacaacttgaggtggaa
gccaagaagtacggccttaactacataaaactcaatggaaatataggttgtatggttaac
ggtgcggggctcgctatggcgactatggacataatcaagctcgcgggaggagaacccgcg
aacttccttgacgtgggtggtggcgcgaacgtagagcaaatcgcgaacgccttcagaata
ctcatggcggacccggacgtgaaggcggtcttcataaatatattcggtggaatactgagg
gtggacaggctggctcagggactcatagaagcctccaaaatggtagaactcagagttccc
attgttgcgagacttgaaggaacgaacgttgaagaaggaaagaggatgctccaagagagt
ggactcaacttcataatagcggaagacatgtgggacggagcgaaaaaggctgtggaaata
gcgaataaacaaagctaa

DBGET integrated database retrieval system