KEGG   Aquifex aeolicus: aq_1705Help
Entry
aq_1705           CDS       T00013                                 

Gene name
galF
Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aae  Aquifex aeolicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    aq_1705 (galF)
   00052 Galactose metabolism
    aq_1705 (galF)
   00500 Starch and sucrose metabolism
    aq_1705 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    aq_1705 (galF)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     aq_1705 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198437..1199330)
Genome map
AA seq 297 aa AA seqDB search
MREIRKVVLPVAGWGTRFLPATKAMPKEMLPIIDKPIIQFIVESFINIGIENIIFVTGRH
KKAIEDHFDHNHELEEHLKKAGKEKLLREVVKISSLINPIYVRQKEQLGLGHAVLMAEPA
VSQEPFFVALGDIIVENEEEELKKMIHLFRKFGNSIVALMEVPKEEVSKYGIAKVKKLDE
ETYIIVDLVEKPSPEEAPSNLAIVGRYIFTPTIFEKLKVTKPGKGGEIQLTDAMRLLLEE
EAIYACKVNNTVYDTGNPKDYLKTVISFALRREDINGELIEFIRGLIKEEPKKEKAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattagaaaggttgttcttcccgttgcggggtggggaacgaggtttttgcct
gctacaaaggcaatgcctaaggaaatgctccccataattgacaaaccaataatccagttc
atagtcgaatcctttatcaacataggtattgaaaacatcattttcgtcacaggtagacac
aagaaagcgatagaggatcactttgaccacaaccacgagctggaagagcacttaaaaaaa
gctggaaaagagaaattactgagagaagttgtaaaaatttcgagccttattaacccgatt
tacgtaaggcaaaaagagcaattaggactcggacatgccgttctcatggctgaaccagcc
gtatcacaggaacccttctttgttgccttaggagacataatcgtggagaacgaagaggaa
gaacttaaaaagatgatacatttgttcaggaagttcggaaactcaatcgtagcattgatg
gaagttccaaaggaagaagtctcaaagtacggtatagcaaaagtaaaaaaattggacgaa
gaaacttatataattgtagatctggtcgaaaaaccctctcccgaagaggctccttccaac
cttgcgatagttggaaggtacatattcacacctaccatttttgaaaaactaaaggttaca
aagccaggtaaaggaggagagatacagttaaccgacgccatgagactcttacttgaggag
gaggcgatatacgcctgcaaggttaataacacggtatacgacacgggaaatcctaaagat
tatctgaaaacggttatatcctttgctttaagaagggaagatataaacggtgaacttatc
gagtttattagaggattgattaaagaagaaccaaaaaaagaaaaggctaaatga

DBGET integrated database retrieval system