KEGG   Aquifex aeolicus: aq_1705Help
Entry
aq_1705           CDS       T00013                                 

Gene name
galF
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aae  Aquifex aeolicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    aq_1705 (galF)
   00052 Galactose metabolism
    aq_1705 (galF)
   00500 Starch and sucrose metabolism
    aq_1705 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    aq_1705 (galF)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     aq_1705 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198437..1199330)
Genome map
AA seq 297 aa AA seqDB search
MREIRKVVLPVAGWGTRFLPATKAMPKEMLPIIDKPIIQFIVESFINIGIENIIFVTGRH
KKAIEDHFDHNHELEEHLKKAGKEKLLREVVKISSLINPIYVRQKEQLGLGHAVLMAEPA
VSQEPFFVALGDIIVENEEEELKKMIHLFRKFGNSIVALMEVPKEEVSKYGIAKVKKLDE
ETYIIVDLVEKPSPEEAPSNLAIVGRYIFTPTIFEKLKVTKPGKGGEIQLTDAMRLLLEE
EAIYACKVNNTVYDTGNPKDYLKTVISFALRREDINGELIEFIRGLIKEEPKKEKAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattagaaaggttgttcttcccgttgcggggtggggaacgaggtttttgcct
gctacaaaggcaatgcctaaggaaatgctccccataattgacaaaccaataatccagttc
atagtcgaatcctttatcaacataggtattgaaaacatcattttcgtcacaggtagacac
aagaaagcgatagaggatcactttgaccacaaccacgagctggaagagcacttaaaaaaa
gctggaaaagagaaattactgagagaagttgtaaaaatttcgagccttattaacccgatt
tacgtaaggcaaaaagagcaattaggactcggacatgccgttctcatggctgaaccagcc
gtatcacaggaacccttctttgttgccttaggagacataatcgtggagaacgaagaggaa
gaacttaaaaagatgatacatttgttcaggaagttcggaaactcaatcgtagcattgatg
gaagttccaaaggaagaagtctcaaagtacggtatagcaaaagtaaaaaaattggacgaa
gaaacttatataattgtagatctggtcgaaaaaccctctcccgaagaggctccttccaac
cttgcgatagttggaaggtacatattcacacctaccatttttgaaaaactaaaggttaca
aagccaggtaaaggaggagagatacagttaaccgacgccatgagactcttacttgaggag
gaggcgatatacgcctgcaaggttaataacacggtatacgacacgggaaatcctaaagat
tatctgaaaacggttatatcctttgctttaagaagggaagatataaacggtgaacttatc
gagtttattagaggattgattaaagaagaaccaaaaaaagaaaaggctaaatga

DBGET integrated database retrieval system