KEGG   Aquifex aeolicus: aq_1708Help
Entry
aq_1708           CDS       T00013                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_1708 (pfkA)
   01230 Biosynthesis of amino acids
    aq_1708 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1708 (pfkA)
   00030 Pentose phosphate pathway
    aq_1708 (pfkA)
   00051 Fructose and mannose metabolism
    aq_1708 (pfkA)
   00052 Galactose metabolism
    aq_1708 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    aq_1708 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    aq_1708 (pfkA)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     aq_1708 (pfkA)
Protein phosphatases and associated proteins [BR:aae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     aq_1708 (pfkA)
Messenger RNA biogenesis [BR:aae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     aq_1708 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200460..1201425)
Genome map
AA seq 321 aa AA seqDB search
MRIGILTAGGDAPGMNAVIRAVVRSAEREGHEVIGIKRGYKGLIEGDFIKLTSRDVGGIL
DRGGTILLSSRDPRYKKLEYREKAYKNLNEQGIEALIILGGEGTLAGAKLTAEETGIPVI
GVPCTIDNDVGGTEYCIGYDTALRNAVDAIDKIRDTASSHERIFIVEVMGRNRGFIAVEA
GLATGAELILIPEERFPREQIPEEIEKAKKLGKLHFIIVLAEGYCRAKELEDFLLEKIGD
KYGEIRSTVLGHIQRGGIPTHFDRIMGTKFGVVAYESLIAGERSGFVAYEKGKFYIEDFE
KAQEYKPIDREAYKLNTRLAI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaggataggaattcttaccgccgggggtgacgcccccggtatgaatgccgtaatcagg
gctgttgtgaggagcgccgaaagggaaggacacgaagtaatcggcataaagagaggctat
aaaggattaatagaaggagattttattaaactcacctccagagacgtggggggaattctg
gacaggggaggaacaatactcctgtcctcaagggaccccagatacaaaaaactcgagtac
agggagaaggcttataaaaacctaaatgaacagggtatagaggctttaataattctcggg
ggtgagggaacacttgcgggtgcaaaactcaccgcggaagaaacgggaattccagtaata
ggcgttccctgtaccatagacaacgacgttggtggaactgagtactgcataggctacgac
acagccctcaggaacgccgttgacgcgatagacaagataagggacaccgcaagctctcac
gagaggattttcatagtagaggttatgggaagaaacagagggtttatagcagttgaggct
ggactcgccacgggtgctgaactcatactcattcccgaagagagattcccgagggaacaa
atccccgaggagatagaaaaggctaagaaactggggaaactccacttcataatagtcctc
gcagaaggatattgccgtgcaaaggaactggaagacttccttctggaaaagatcggtgat
aagtacggggagatacgctcaaccgttctgggacatatccagagaggaggaataccaacc
cactttgacaggataatgggaacaaagttcggagttgtggcttatgagagtctcatcgca
ggagaacgctcaggatttgttgcctacgaaaagggcaagttttacatagaggacttcgaa
aaagctcaggaatacaaaccaatagacagggaagcttacaaactaaacacgagactggct
atataa

DBGET integrated database retrieval system