KEGG   Aquifex aeolicus: aq_1740Help
Entry
aq_1740           CDS       T00013                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
aae  Aquifex aeolicus
Brite
Enzymes [BR:aae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     aq_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1225416..1225934
Genome map
AA seq 172 aa AA seqDB search
MRRAIGFLLIVITFTFASLYEEFVKEQVKELPLDKAVVVGTGKKELIIFVNPDCPHCRHE
WKSLREHLDKLKIYVFVVPFKAWGEDNLKKAYYIVCSQNPEKALDEVLTGKVDGKNLNPP
TCELLNYHLKAADIVGLRGVPLNIIPDKGKVIEGASPKLLEELGITSAGSRD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagggcaattggtttcctcctgatagtaataactttcacttttgcttccctttac
gaagaatttgtaaaggaacaggtaaaagaacttcctttggacaaggctgtggtagtcgga
acaggtaaaaaagaattaataatcttcgtaaacccggattgccctcactgcaggcacgaa
tggaagagtttaagggaacatctggacaagctcaagatttacgtcttcgtggttcctttc
aaagcgtggggtgaggacaacttaaaaaaagcctactatatagtctgttcacaaaacccc
gaaaaagctttagacgaagtacttaccggaaaagtggacggtaaaaatttaaatcctcct
acatgtgaattactgaattatcacctgaaagccgcagatatcgtaggactaaggggtgtt
ccgctgaacataattcccgacaaaggaaaagttatagaaggtgcaagccctaaacttctg
gaagagctcgggataacttcagcgggaagcagagactaa

DBGET integrated database retrieval system