KEGG   Aquifex aeolicus: aq_175Help
Entry
aq_175            CDS       T00013                                 

Definition
(RefSeq) hypothetical protein
  KO
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
aae  Aquifex aeolicus
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:aae00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    aq_175
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    aq_175
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    aq_175
Mitochondrial biogenesis [BR:aae03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    aq_175
Secretion system [BR:aae02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   aq_175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(107287..108795)
Genome map
AA seq 502 aa AA seqDB search
MMDNDNQFWKRFLIFTILMFLFITAYELFYIYYVKPSQPQKTEKKEVVKKEEFKNVNLPQ
LMLGTFREKQEYKNTKTVKLGIYSLELSEKGGKILRFIDQKYGFDLISKAERELKIFPLE
IFTGNPDLDQKLNFGEYEIKEGKNSVELIHKELKVKKILSYKNGAIHLSVEGLKPPFWVF
VGSPPDDEAFYTHVGPVLKINGEVVRLDVDDLKGINEFEGNIEFGGEESRYFFKGAKDYQ
KHIVYKVKLGDKFVSLSTFLYDGEKTIYLGAKDYARLRELGLVDTLDWGTLKIIVKPLFL
FLYWIYEHTGSWVLSILVLTFIVRIFLFPLGYKSVVSMQKLQELAPKMEKIKQKYKDDPV
KMQEEMMKLYAETGFNPMAGCLPILLQIPIFFALYKVLIITVDLKVSSFLWIPSLADKDP
YYILPVIMGLTMILQQKMTPSPDPKQALVGYITSVAFTLLFINFPAGLVLYWTLNNVFNI
IQNYLIKEVLLKDKSKGGSKKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgatggacaacgacaaccagttctggaaaaggtttttaatattcacaatcttaatgttt
ttattcataaccgcttacgagctattttacatttattacgttaaaccctctcaacctcaa
aaaacagaaaaaaaagaagtagtaaaaaaagaagagtttaaaaacgtaaaccttccccag
ttaatgctcggaactttcagagaaaaacaggagtataaaaacactaaaactgtaaaacta
ggaatttattccttggaattgtctgaaaaaggcgggaaaattttaagatttatagatcag
aagtacggctttgatttaatatcgaaagctgaaagagagttaaaaatattccctctggag
atattcacgggaaatccagaccttgatcagaaattaaactttggagaatacgaaattaaa
gaaggtaaaaactcagtcgaattaatccacaaggagctgaaagtaaagaaaatactttcc
tataaaaacggagcaattcatttaagcgttgaaggattaaaaccacccttctgggtgttt
gtaggttctcctcccgatgatgaggcattttatacacacgtaggacctgttctgaaaata
aacggggaagttgtaaggcttgatgtggatgatctaaagggtataaatgagtttgaaggg
aatattgagtttggaggagaggaaagcaggtacttctttaaaggggcaaaggattaccag
aaacacatagtttacaaagtaaaactaggagataaatttgtatcactttccactttcctt
tacgatggagagaagaccatataccttggtgcgaaggactatgcaaggctcagagaactt
ggtttggtagataccttagactggggaactttaaagataatagtaaaaccgctctttctc
ttcctgtactggatatacgaacacacgggaagctgggttctctctatcctcgttctcacg
tttatagtcaggattttcctcttcccgctggggtacaaaagcgtagtttctatgcaaaag
cttcaagaactcgcccctaaaatggaaaagattaaacagaagtataaggacgatcccgta
aagatgcaggaagagatgatgaaactctacgcggaaacgggattcaaccctatggcagga
tgccttcccatactcctccagatacctatattctttgcgctatacaaggttctcataata
accgtagatctgaaagtcagcagtttcctctggattcccagccttgcggacaaggatccc
tattacatacttcccgttattatgggacttaccatgatacttcagcaaaagatgactcct
tcccccgatccaaagcaggcccttgtgggatacataacctcggtggcattcacattactc
tttataaacttcccggcgggactggttctttactggacgctgaacaacgtattcaatatt
attcagaactatttgataaaagaggttctccttaaagacaaatcaaaaggggggagtaag
aaaaaatga

DBGET integrated database retrieval system