KEGG   Aquifex aeolicus: aq_1790Help
Entry
aq_1790           CDS       T00013                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_1790
   01230 Biosynthesis of amino acids
    aq_1790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1790
   00030 Pentose phosphate pathway
    aq_1790
   00051 Fructose and mannose metabolism
    aq_1790
  Energy metabolism
   00680 Methane metabolism
    aq_1790
Enzymes [BR:aae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     aq_1790
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     aq_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1262655..1263800)
Genome map
AA seq 381 aa AA seqDB search
MKVTLSVIKADIGGFVGHSSTHPDVVNAVREHVEKEVEKGNLIDCDILTCGDDIAIVMTH
THGVDAELVHKIAWDAFMKGTEVAKKLKLYGAGQDLLTDTFSGNVKGMGPGVAEMEFEER
PSEPVIVFFADKTSPSAWNLPLYEMFADPMNTAGLVIDPKMHDGFTFEVLDVYTGKAVKL
NTPAEVYDLLALIGSVGKYVVKNVYRNYDGEIAATASTQRLSLIAGQYVGKDDPVLIVRA
QSGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFEDARPSRFDGPPRVIGAGYQLAN
GKLIGPADMFKDPAFDKARQVAQDMADILRRQGIFEPHRLPAEEMEYTTLPKVLKKLENR
FYDTEVEKLSEEQKIEKEDMD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaactttgagcgtgattaaggcggacataggggggtttgtgggacactcttca
actcaccctgatgttgtaaacgctgtaagagaacacgttgaaaaagaagtagagaaggga
aacctcatagactgtgatattttgacctgcggtgacgatatagcgatagttatgactcat
actcacggagtggacgcggaactggttcacaagatagcttgggacgcctttatgaaggga
acggaagtcgcaaagaagttaaaactctacggagcgggacaggacctcctcacggatacc
ttcagcggaaacgttaagggaatgggtccgggcgtagcggaaatggagtttgaagaaaga
ccctctgaacccgtaatagtgttctttgcggacaaaacttctccgagtgcttggaactta
ccgctttacgagatgttcgcagatcccatgaacacagccgggctcgtaatagaccccaaa
atgcacgacggatttacctttgaagttctggacgtttacacgggaaaggcggtaaagctt
aatacccctgctgaagtctacgatctccttgcgttaataggttccgtcggaaagtacgtc
gttaagaacgtttacaggaattacgacggggaaattgccgcaacggcttcaactcaaagg
ctttcactcatagcgggtcagtacgtaggaaaggacgaccccgtcctgatcgtgagggct
cagagcggatttcccgcagtgggagaaattctcgaaccctttgcaagaccctggatagtt
gaaggatggatgaggggttcccacaacggacctttaatgcccgtttcctttgaagacgca
agaccctccagatttgacggacctcccagagtaataggtgcgggataccagctcgccaac
ggaaaactcattggacctgctgatatgttcaaagatcctgcctttgataaggcaagacag
gtagctcaagatatggcggatatactcaggagacagggaatattcgaacctcacagactc
cctgcggaagagatggagtatacaacgctcccgaaagttctcaagaagctcgaaaacagg
ttctacgacacggaagtcgagaagttatccgaggaacaaaaaatagaaaaagaggatatg
gactaa

DBGET integrated database retrieval system