KEGG   Aquifex aeolicus: aq_1790Help
Entry
aq_1790           CDS       T00013                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
aae  Aquifex aeolicus
Pathway
aae00010  Glycolysis / Gluconeogenesis
aae00030  Pentose phosphate pathway
aae00051  Fructose and mannose metabolism
aae00680  Methane metabolism
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01200  Carbon metabolism
aae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1790
   00030 Pentose phosphate pathway
    aq_1790
   00051 Fructose and mannose metabolism
    aq_1790
  Energy metabolism
   00680 Methane metabolism
    aq_1790
Enzymes [BR:aae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     aq_1790
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     aq_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-GeneID: 1193466
NCBI-ProteinID: NP_214225
UniProt: O67659
Position
complement(1262655..1263800)
Genome map
AA seq 381 aa AA seqDB search
MKVTLSVIKADIGGFVGHSSTHPDVVNAVREHVEKEVEKGNLIDCDILTCGDDIAIVMTH
THGVDAELVHKIAWDAFMKGTEVAKKLKLYGAGQDLLTDTFSGNVKGMGPGVAEMEFEER
PSEPVIVFFADKTSPSAWNLPLYEMFADPMNTAGLVIDPKMHDGFTFEVLDVYTGKAVKL
NTPAEVYDLLALIGSVGKYVVKNVYRNYDGEIAATASTQRLSLIAGQYVGKDDPVLIVRA
QSGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFEDARPSRFDGPPRVIGAGYQLAN
GKLIGPADMFKDPAFDKARQVAQDMADILRRQGIFEPHRLPAEEMEYTTLPKVLKKLENR
FYDTEVEKLSEEQKIEKEDMD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaactttgagcgtgattaaggcggacataggggggtttgtgggacactcttca
actcaccctgatgttgtaaacgctgtaagagaacacgttgaaaaagaagtagagaaggga
aacctcatagactgtgatattttgacctgcggtgacgatatagcgatagttatgactcat
actcacggagtggacgcggaactggttcacaagatagcttgggacgcctttatgaaggga
acggaagtcgcaaagaagttaaaactctacggagcgggacaggacctcctcacggatacc
ttcagcggaaacgttaagggaatgggtccgggcgtagcggaaatggagtttgaagaaaga
ccctctgaacccgtaatagtgttctttgcggacaaaacttctccgagtgcttggaactta
ccgctttacgagatgttcgcagatcccatgaacacagccgggctcgtaatagaccccaaa
atgcacgacggatttacctttgaagttctggacgtttacacgggaaaggcggtaaagctt
aatacccctgctgaagtctacgatctccttgcgttaataggttccgtcggaaagtacgtc
gttaagaacgtttacaggaattacgacggggaaattgccgcaacggcttcaactcaaagg
ctttcactcatagcgggtcagtacgtaggaaaggacgaccccgtcctgatcgtgagggct
cagagcggatttcccgcagtgggagaaattctcgaaccctttgcaagaccctggatagtt
gaaggatggatgaggggttcccacaacggacctttaatgcccgtttcctttgaagacgca
agaccctccagatttgacggacctcccagagtaataggtgcgggataccagctcgccaac
ggaaaactcattggacctgctgatatgttcaaagatcctgcctttgataaggcaagacag
gtagctcaagatatggcggatatactcaggagacagggaatattcgaacctcacagactc
cctgcggaagagatggagtatacaacgctcccgaaagttctcaagaagctcgaaaacagg
ttctacgacacggaagtcgagaagttatccgaggaacaaaaaatagaaaaagaggatatg
gactaa

DBGET integrated database retrieval system