KEGG   Aquifex aeolicus: aq_2093Help
Entry
aq_2093           CDS       T00013                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aae  Aquifex aeolicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471392..1472108
Genome map
AA seq 238 aa AA seqDB search
MKKLSFILLSAAFVYASCPEPSKFEEKLKEITQREWKVQAVSEVKDLGLCQVVVKRGLEP
LVIYMDKDMNYLITGNVIDLKNGKNLTAETVRKYAKVSPEVLKELEKMTDLKFGKGDKYV
YFISDPHCPYCNRLAPILKNWADKNDVQIRVIFYPLPFHKGADEKAASLICKKDVKYEEL
HTKDKPEKVCEEGMEKVKKNVEYLSKLGVTGTPTLIGMNGKVLVGLPRSEKQLDELVK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttgtcttttattttactctccgcagcatttgtttacgcttcatgccctgaa
ccctccaaatttgaagagaaattaaaagaaataacccaaagggagtggaaagttcaggca
gtatctgaggtaaaagacctgggattgtgtcaggtggtagtaaagagaggacttgaaccc
ttagttatttacatggacaaggatatgaactacttgattactggaaacgttattgacctc
aagaacggcaaaaatctaactgcagaaaccgtaaggaagtacgcaaaagtatcccccgaa
gttttgaaagagcttgaaaagatgacagacctcaaattcggaaaaggagacaagtacgtt
tactttatatcagacccccactgcccttactgtaacagacttgcaccaatactgaaaaac
tgggctgataaaaatgacgtacagataagggtaatcttctacccgcttcccttccacaaa
ggagcggatgaaaaggctgcaagccttatatgtaaaaaggatgtaaagtacgaggagctt
cacacaaaagacaagcccgaaaaggtttgtgaggaaggaatggaaaaggtaaagaaaaac
gtagagtacctctcaaagctcggtgtcaccggaacacctacactcatcggtatgaacggt
aaagttttggttggtcttccgagaagtgaaaaacagcttgatgaactcgttaaataa

DBGET integrated database retrieval system