KEGG   Aquifex aeolicus: aq_360Help
Entry
aq_360            CDS       T00013                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:aae01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aae01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aae00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aae00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aae00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(237559..238302)
Genome map
AA seq 247 aa AA seqDB search
MRRLIAANWKMNKTVKETEEYINTFLKFVEHPESREILICPPFTSLYVAGKMLQGTGVKL
GAQNCHYEKRGAFTGEISIPMLQEVGCEYVIVGHSERRHIFGESDELIHKKIVACLEMGI
RPILCVGEKKEEREAGMTFKVIETQIKLALTGVEEHTDKIDIAYEPVWAIGTGTPATPED
AVEVHTFIRNLINQLNPKNEGKTRILYGGSVNPQNAKEFMKHEEINGLLVGTASLDPESF
AKIVYSF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaagattaatagccgcaaactggaagatgaacaaaacggtaaaggaaaccgaagag
tacattaacaccttcctgaagttcgttgaacaccccgaaagcagggagatactcatatgt
cctccttttacttccctctacgttgcgggtaaaatgcttcagggaacgggtgtaaagctt
ggagctcaaaactgtcactacgaaaagaggggagcctttacgggagagatatcaataccc
atgctccaagaagttgggtgtgagtacgtgatagtgggacactcagagagaaggcacata
ttcggtgagagtgacgagttaattcacaagaagatagttgcgtgcttagagatgggaata
agacccattttatgcgttggggaaaagaaagaagagagggaagctgggatgacctttaag
gtcattgaaacacagataaaactcgcactcacaggtgtggaagagcatacggataaaata
gacatagcgtacgaacccgtgtgggctatcggaaccggaacacccgcaacccccgaagat
gctgttgaggttcacaccttcataaggaacttaataaaccagctcaatcccaaaaacgaa
gggaagacccgtatcctctacggaggaagtgtaaacccacagaacgcaaaagagttcatg
aaacacgaagagataaacggactactcgtaggaactgcaagcctagaccctgaatccttt
gcgaagatcgtatactccttttaa

DBGET integrated database retrieval system