KEGG   Aquifex aeolicus: aq_360Help
Entry
aq_360            CDS       T00013                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_360 (tpiA)
   01230 Biosynthesis of amino acids
    aq_360 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_360 (tpiA)
   00051 Fructose and mannose metabolism
    aq_360 (tpiA)
   00562 Inositol phosphate metabolism
    aq_360 (tpiA)
Enzymes [BR:aae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     aq_360 (tpiA)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   aq_360 (tpiA)
  Exosomal proteins of bladder cancer cells
   aq_360 (tpiA)
  Exosomal proteins of melanoma cells
   aq_360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(237559..238302)
Genome map
AA seq 247 aa AA seqDB search
MRRLIAANWKMNKTVKETEEYINTFLKFVEHPESREILICPPFTSLYVAGKMLQGTGVKL
GAQNCHYEKRGAFTGEISIPMLQEVGCEYVIVGHSERRHIFGESDELIHKKIVACLEMGI
RPILCVGEKKEEREAGMTFKVIETQIKLALTGVEEHTDKIDIAYEPVWAIGTGTPATPED
AVEVHTFIRNLINQLNPKNEGKTRILYGGSVNPQNAKEFMKHEEINGLLVGTASLDPESF
AKIVYSF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaagattaatagccgcaaactggaagatgaacaaaacggtaaaggaaaccgaagag
tacattaacaccttcctgaagttcgttgaacaccccgaaagcagggagatactcatatgt
cctccttttacttccctctacgttgcgggtaaaatgcttcagggaacgggtgtaaagctt
ggagctcaaaactgtcactacgaaaagaggggagcctttacgggagagatatcaataccc
atgctccaagaagttgggtgtgagtacgtgatagtgggacactcagagagaaggcacata
ttcggtgagagtgacgagttaattcacaagaagatagttgcgtgcttagagatgggaata
agacccattttatgcgttggggaaaagaaagaagagagggaagctgggatgacctttaag
gtcattgaaacacagataaaactcgcactcacaggtgtggaagagcatacggataaaata
gacatagcgtacgaacccgtgtgggctatcggaaccggaacacccgcaacccccgaagat
gctgttgaggttcacaccttcataaggaacttaataaaccagctcaatcccaaaaacgaa
gggaagacccgtatcctctacggaggaagtgtaaacccacagaacgcaaaagagttcatg
aaacacgaagagataaacggactactcgtaggaactgcaagcctagaccctgaatccttt
gcgaagatcgtatactccttttaa

DBGET integrated database retrieval system