KEGG   Aquifex aeolicus: aq_360Help
Entry
aq_360            CDS       T00013                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aae  Aquifex aeolicus
Pathway
aae00010  Glycolysis / Gluconeogenesis
aae00051  Fructose and mannose metabolism
aae00562  Inositol phosphate metabolism
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01200  Carbon metabolism
aae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_360 (tpiA)
   00051 Fructose and mannose metabolism
    aq_360 (tpiA)
   00562 Inositol phosphate metabolism
    aq_360 (tpiA)
Enzymes [BR:aae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     aq_360 (tpiA)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   aq_360 (tpiA)
  Exosomal proteins of bladder cancer cells
   aq_360 (tpiA)
  Exosomal proteins of melanoma cells
   aq_360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1193012
NCBI-ProteinID: NP_213246
UniProt: O66686
Position
complement(237559..238302)
Genome map
AA seq 247 aa AA seqDB search
MRRLIAANWKMNKTVKETEEYINTFLKFVEHPESREILICPPFTSLYVAGKMLQGTGVKL
GAQNCHYEKRGAFTGEISIPMLQEVGCEYVIVGHSERRHIFGESDELIHKKIVACLEMGI
RPILCVGEKKEEREAGMTFKVIETQIKLALTGVEEHTDKIDIAYEPVWAIGTGTPATPED
AVEVHTFIRNLINQLNPKNEGKTRILYGGSVNPQNAKEFMKHEEINGLLVGTASLDPESF
AKIVYSF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaagattaatagccgcaaactggaagatgaacaaaacggtaaaggaaaccgaagag
tacattaacaccttcctgaagttcgttgaacaccccgaaagcagggagatactcatatgt
cctccttttacttccctctacgttgcgggtaaaatgcttcagggaacgggtgtaaagctt
ggagctcaaaactgtcactacgaaaagaggggagcctttacgggagagatatcaataccc
atgctccaagaagttgggtgtgagtacgtgatagtgggacactcagagagaaggcacata
ttcggtgagagtgacgagttaattcacaagaagatagttgcgtgcttagagatgggaata
agacccattttatgcgttggggaaaagaaagaagagagggaagctgggatgacctttaag
gtcattgaaacacagataaaactcgcactcacaggtgtggaagagcatacggataaaata
gacatagcgtacgaacccgtgtgggctatcggaaccggaacacccgcaacccccgaagat
gctgttgaggttcacaccttcataaggaacttaataaaccagctcaatcccaaaaacgaa
gggaagacccgtatcctctacggaggaagtgtaaacccacagaacgcaaaagagttcatg
aaacacgaagagataaacggactactcgtaggaactgcaagcctagaccctgaatccttt
gcgaagatcgtatactccttttaa

DBGET integrated database retrieval system