KEGG   Aquifex aeolicus: aq_409Help
Entry
aq_409            CDS       T00013                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aae  Aquifex aeolicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aae00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aae00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(277239..278114)
Genome map
AA seq 291 aa AA seqDB search
MRSLISSLDLTREEVEEILKYAKEFKEGKEETIKASAVLFFSEPSTRTRLSFEKAARELG
IETYLVSGSESSTVKGESFFDTLKTFEGLGFDYVVFRVPFVFFPYKEIVKSLNLRLVNAG
DGTHQHPSQGLIDFFTIKEHFGEVKDLRVLYVGDIKHSRVFRSGAPLLNMFGAKIGVCGP
KTLIPRDVEVFKVDVFDDVDKGIDWADVVIWLRLQKERQKENYIPSESSYFKQFGLTKER
FEKVKLYMHPGPVNRNVDIDHELVYTEKSLIQEQVKNGIPVRKAIYKFLWT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcttgataagttctttggacctgacgagggaagaagtagaggaaatactaaaa
tacgcaaaggagttcaaggaaggaaaagaagaaaccataaaagcgtccgcggttttgttt
ttctccgaaccctccacgagaacacgcctatcctttgaaaaggcagcaagggaactgggg
attgaaacttacttagttagcggttcggaaagttctacggtaaagggagagagtttcttt
gatacgttgaaaacttttgagggactcggatttgattacgttgtgttcagagtgcctttc
gtgtttttcccttacaaagaaatcgttaaatccttgaacttgagactcgtaaacgcaggg
gacggaactcaccagcacccttctcagggacttatagacttcttcacaataaaagagcac
ttcggagaagtaaaagacttaagagtcctttacgtgggtgatatcaaacacagcagagtt
tttcgttcaggagctcctcttttgaacatgtttggtgcaaagataggagtttgcggacca
aaaacgttgataccgagggacgtggaagttttcaaagtagacgtttttgacgacgttgat
aaaggcatagattgggcagacgtggtcatatggcttagacttcaaaaggaaagacagaag
gaaaactatattccttcagaaagcagttatttcaaacaattcggtctaacaaaagaaagg
tttgaaaaggtaaagctctacatgcacccgggacctgtaaacaggaatgtggacatagac
cacgagcttgtctatacggaaaaatcccttatacaggaacaggtaaagaacggtattcct
gtgaggaaggctatatacaaattcttatggacctag

DBGET integrated database retrieval system