KEGG   Aquifex aeolicus: aq_425Help
Entry
aq_425            CDS       T00013                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aae  Aquifex aeolicus
Pathway
aae00260  Glycine, serine and threonine metabolism
aae00750  Vitamin B6 metabolism
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01230  Biosynthesis of amino acids
Module
aae_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    aq_425 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    aq_425 (thrC2)
Enzymes [BR:aae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     aq_425 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1193066
NCBI-ProteinID: NP_213300
UniProt: O66740
Structure
PDB: 

Jmol
Position
complement(290643..291701)
Genome map
AA seq 352 aa AA seqDB search
MNRWQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKGKIYLKYEGLNPTG
SFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLS
QAMIYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEA
PDYHFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAEGAAPIVKGYPIKNPQTIA
TAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLI
KLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEPITVPPDFDEVVKVLGF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggtggcaaggaataattaaacagtataaaaagtacctccccgttgacgaaaac
acacccatcgtaaccctctacgaaggtaacactcctctcatagaggcggacaacctcgca
agggcgataggttttaaaggaaagatttatctgaagtacgaaggactaaatccgactggt
tcttttaaagatagggggatgacccttgccatttcgaaagcagtggaagcgggtaaaaga
gcggtgatatgtgcatccacgggaaacacctccgcttccgccgcggcttacgctgcaagg
gctggactcagggcttacgttctgctacccaagggtgctgtcgccataggaaagctctct
caggctatgatttacggggctaaagtcctcgccattcaaggaacttttgacgatgccctg
aacatagtgagaaaaataggtgaaaattttcccgtggaaattgtgaactcggtcaacccc
tatagaatagaggggcaaaagacagccgcttttgagatatgcgataccttgggagaggct
ccagattatcactttatcccagtcgggaacgcaggaaacataaccgcctactggaagggc
tttaagatttattacgaggaggggaaaataacgaaactccctaggatgatgggctggcaa
gcggaaggtgctgctcctatagtgaagggctacccgattaaaaatccccagaccatagct
acggctataaagataggaaatccctacagctggaagtctgccctgaaagccgctcaggag
agtggtgggaaaatagatgcggtaagtgacagcgaaatcctttatgcttacaaactcatc
gcctcaacggaaggtgttttctgcgagcctgcttctgccgcgagcgtggcagggttgata
aaactcgtaagggaaggcttttttaaaggcggagaagtggtaacgtgtacacttaccgga
aacggtttaaaggaccccgataccgctataaaagtttgtgaagaacctataacagtacct
ccggattttgacgaggtagtaaaggttctaggtttttaa

DBGET integrated database retrieval system