KEGG   Aquifex aeolicus: aq_434Help
Entry
aq_434            CDS       T00013                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aae  Aquifex aeolicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    aq_434 (glpK)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     aq_434 (glpK)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   aq_434 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(294816..296294)
Genome map
AA seq 492 aa AA seqDB search
MSVVISIDVGTTRVKVIAFSKNGKIVAISDREVSQIYPEPGWVEQDPLELWEAVRKSLSE
VIQQVGLKEINSIGITNQRETVILWDKETGRPVYNAILWQDLRTEDICRKLSEYSEYIKE
NTGLLLHPYFSASKVNWIIENVNGVKKDIERGKVIFGTVDTWILWNLTGGKVHKTEPSNA
SRTLLFNIKRLEYDDELLKIFRIPKNILPEVNESSSLFGYTDKSITGVEIPITGILGDQQ
ASLFAHGIRELEEVKNTYGTGLFLMLLTGSKPIIPERLLGTVAWVINGKVNYAIEGSVLT
GGACIKWLMDRLKLIKQAADTEYLAKSISSNEGVYFVPAFSGLGAPYWDASARGIIIGIT
GRTRIEHIARAALEAIAYQTRDVIEEMEKETGVKIKILKADGGASQNNFLMQFQADILGI
PVERPRHVELTALGAAGIAGIYSGMWKSKEEFIEDTREVELTFSPEMKKEERELYYSKWK
DAVKRAMKWSML
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgttatttcaatagatgtagggacaactagagtaaaagttatcgcattttca
aaaaatggaaaaatagttgcaatttctgacagggaagtttcacagatatatccagaacct
ggatgggtagaacaagatcctcttgagctttgggaagccgttagaaagtctttgagcgag
gttattcaacaggttgggttaaaggaaataaattcaattggaattacaaaccagagggaa
actgttatcctttgggataaggaaaccggaagaccggtttacaacgcaatactctggcag
gatttaagaactgaggatatatgtagaaaactctccgaatactctgaatacataaaggaa
aatacaggccttctcttacatccttatttttccgcaagcaaagtaaactggataatagaa
aacgtaaacggggtaaagaaagacattgagaggggaaaggtaatatttggaacagttgat
acgtggattctctggaacttaacaggaggaaaggttcacaaaactgaaccgagtaacgct
tcaagaacccttctattcaacattaaaagacttgaatacgatgatgaactgttaaaaata
ttcaggatacctaaaaatatactcccggaggtgaatgaaagttcttcccttttcggatac
acggataaaagtattacaggtgttgaaatacctattacaggaattctgggtgatcagcag
gcctcacttttcgctcacggaataagggaattagaggaggttaaaaacacttatggaaca
ggtttattccttatgcttttaacgggaagtaaaccgataatacccgaaaggttacttgga
acagtagcctgggttataaatggtaaggtaaattacgcaattgaaggaagtgtactgacc
ggaggagcctgtataaagtggttaatggacaggcttaaattaataaagcaggctgccgat
acggaatacctggcaaaatccatcagctcaaatgaaggtgtttacttcgttccagctttt
tcgggtcttggagctccttactgggatgcgtcagcaaggggaataataatagggattacg
ggaaggacaagaatagaacacatagcaagagctgcattagaagcaatagcgtatcaaaca
agggatgtaattgaagaaatggaaaaggaaacgggagtgaagataaaaatcttaaaagcg
gatggaggagcttctcagaacaatttcctaatgcagtttcaggctgacattcttggcata
cctgttgaaagacctaggcatgtagaacttacagctctgggagcggctggaattgcaggt
atatactcaggaatgtggaagagtaaagaggaattcattgaggatacaagggaagttgaa
ttaactttcagtccagaaatgaaaaaagaggaaagggagctttactactccaagtggaag
gatgctgtaaagagagccatgaaatggagtatgttatga

DBGET integrated database retrieval system