KEGG   Aquifex aeolicus: aq_547Help
Entry
aq_547            CDS       T00013                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aae  Aquifex aeolicus
Pathway
aae00300  Lysine biosynthesis
aae01100  Metabolic pathways
aae01120  Microbial metabolism in diverse environments
aae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    aq_547 (dapE)
Enzymes [BR:aae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     aq_547 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1193241
NCBI-ProteinID: NP_213383
UniProt: O66823
Position
371023..371922
Genome map
AA seq 299 aa AA seqDB search
MVIREAVKETLKELIRIPSVSGKEKGVLEYVENRLKSLGIPLKRQEIEKDRYNLVYDNGS
EYLISVHVDTVPPAGFRDAYRPKEVNGRIYGRGASDVKGAIASLITAVEWFKKDFPEKEL
PVSLAFVVDEEQNTALGSENLPKCLNGKRKCIVLEPTYGLVCTKQYGAYEFSVKIKCKSA
HGSEFEKVENPVKVFIKLLNKLEEVLKREVNVIMVRSGTKVYTVPKTCEALLEFKVFEGE
RKEELEKKVQEVVSALNTECEITVKLEGFEEFQEFNTDGLLDVVKKALLKGGRRSKRKG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggttatcagggaagcggtgaaggagactctcaaagaactcataaggattccgagcgta
tctggaaaggaaaagggagtgctggagtacgtagaaaacagactcaaaagccttggtatt
cctctaaagagacaggaaatagaaaaggacaggtataacctcgtttacgacaacggttcg
gagtacctgatttcagttcacgtagacactgtaccgcctgcaggtttcagggacgcttac
aggccgaaggaggtaaacggaaggatttacgggaggggagcgagcgacgttaaaggcgca
atagcgagcttaattaccgcggttgagtggttcaaaaaggattttcccgaaaaggaactg
cccgtttcccttgcttttgtcgttgacgaggaacaaaacacggcccttggttctgaaaac
ttgccaaagtgtctaaacggaaagaggaagtgtatagtccttgaacccacttatgggctc
gtttgcacgaagcagtatggagcttacgagttttcggtaaagataaagtgcaaatccgcc
cacggttctgagttcgaaaaggttgaaaatcccgtaaaggtatttataaaactcctaaac
aaactcgaagaagtcctgaaaagggaagtaaacgtaataatggtaaggagcggcacgaaa
gtctacaccgttcccaaaacctgtgaagctctcctagagtttaaggtttttgaaggggaa
aggaaggaagagcttgagaagaaggttcaagaggtggtgagtgctttaaacacagagtgt
gaaatcactgtaaaactggaaggctttgaggagtttcaggagttcaacacggacggacta
ttagatgtggttaaaaaggctcttttaaaaggtggaaggagaagcaaaaggaagggataa

DBGET integrated database retrieval system