KEGG   Aquifex aeolicus: aq_608Help
Entry
aq_608            CDS       T00013                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aae  Aquifex aeolicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    aq_608 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    aq_608 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    aq_608 (thrC1)
Enzymes [BR:aae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     aq_608 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(414196..415425)
Genome map
AA seq 409 aa AA seqDB search
MAKVKGLKCRECGREYPAEPIHVCEFCFGPLEVVYDYDEIKKNISREKIEKGPKSLWRYV
DLLPVENPTVGLTAGFTPLKKAEKLGEVLGLKNLYIKDDSVNHPTLSFKDRVVSVALSKA
KEFGFDTAACASTGNLANSVAAHSAQAGMNCFVFIPANLETQKIIGSLVFNPTVVAVEGN
YDDVNRLCSEIANDLGWAFVNINIRPYYAEGSKTLAFEVAEQLGWRAPDVVVAPAASGSL
YTKIWKGFNELKKVGLIDEVKTRMYGAQAEGCSPIAQAWREGRDFIKPVKPNTIAKSIAI
GNPADGIYALQVARESNGAWETATDEEIIEGIKLLAQTEGIFTETAGGTTIAVLKKYVEK
GMISPEETVVVYITGNGYKTMEVLEGKLSTPVKIKPTLKDFKEKVLARV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtaaagggattaaagtgccgtgagtgtggaagggaataccccgccgagccc
atacacgtttgtgagttttgctttggtccgcttgaagttgtatacgactacgatgagata
aagaaaaatatttccagagaaaagatagaaaaaggaccaaagagtttatggagatatgtt
gacctgcttcccgtagaaaaccccacggtaggacttacggcgggatttacgccccttaaa
aaggcggaaaaacttggagaagtcctcggtcttaagaacctttacataaaggacgacagc
gtaaaccaccctaccctttccttcaaagacagggttgtgtccgtggcactttccaaggca
aaagagttcggatttgatactgcggcctgtgcttccactggaaacctcgcaaactccgtt
gcggcccactccgctcaggcgggaatgaactgcttcgtgtttatacctgcaaaccttgaa
acccagaaaattataggttctcttgtctttaaccccaccgttgttgcagttgaggggaat
tacgacgacgttaacaggctatgttccgagattgcaaacgacctcggctgggcctttgtg
aacataaatataagaccatactacgcggaaggttcaaaaaccttagcctttgaagtcgct
gaacagctcggctggagagctcccgacgtagttgtagcacccgcggcatcgggttctctt
tacaccaaaatatggaaaggctttaatgaactaaaaaaagtcggcttaatagacgaagta
aagacgagaatgtacggtgctcaggcagaggggtgctccccgatagctcaggcgtggaga
gagggaagggacttcataaaacctgtgaaacccaacaccatagccaagtccatagcgatt
ggaaatcccgcggacggtatatacgcccttcaggtagcaagggaaagcaacggtgcgtgg
gaaacagcaacggacgaggaaataatagaaggtattaaactcctcgcacaaaccgaaggc
atatttacagaaaccgcaggaggaacaacgatagcagttctcaagaaatacgtagaaaag
ggaatgatttcccccgaagagaccgtagttgtttacataacggggaacggctataaaact
atggaagttctggaagggaaactaagcacacctgtgaagataaaaccgacgttaaaagac
ttcaaagaaaaagttcttgcaagagtttaa

DBGET integrated database retrieval system