KEGG   Aquifex aeolicus: aq_689Help
Entry
aq_689            CDS       T00013                                 

Definition
(RefSeq) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
aae  Aquifex aeolicus
Brite
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     aq_689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(468404..469414)
Genome map
AA seq 336 aa AA seqDB search
MEFKCRIHEKIREGEELNEVDKRNLKEVIKRMFNFFVEHNIVPVPRNYAKWFFVFCYIVE
NNIEATTEQIIDIYYKIFKEAKIDLRLSNEIERILTEVRHTVYEYLETVEKYDKKIEKHE
KTLEDYSRQEEISILKDILKEVSELRKVNQELIAKLQEKQKETERLKKELDALKKQAFID
YLTGLKNRRSIQKALEDYFKDYKNYGYPFSVIMMDLNNFKEINDEYGHLVGDCILKGIGE
ILRKYLRAKDAIGRYGGDEFLIILPGVKLEDAVNIARRLKTVIQNHTFYCEDKELKVSAS
FGILEVNENFNSPEEILKEVDKKLYEAKKNPDHIAY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaattcaagtgcaggatccatgagaaaataagggaaggggaagaattaaacgaagta
gataaaagaaacctgaaggaagtaataaagcgtatgtttaacttctttgttgagcataac
atagtccccgttccccggaactacgcgaagtggtttttcgtattttgctacatcgttgaa
aataacatagaggcaactacggagcaaataatagacatatactacaagattttcaaagaa
gctaaaatagacctgaggctttctaacgagatagaaagaattcttactgaagttagacac
acggtttacgagtatctggagacggttgaaaagtacgataaaaagatagaaaagcacgaa
aaaaccttggaagattactcaaggcaggaagaaattagcattttaaaggatattttgaaa
gaggtttccgaactgaggaaagtcaatcaagagttaatagcaaagcttcaagaaaaacaa
aaggaaacagaaagactcaaaaaagaacttgacgctttaaagaaacaggcttttatagat
tacctcaccggattaaaaaacaggcgttctattcagaaagctctggaggattacttcaag
gattataaaaactacggataccccttctccgtaataatgatggatttaaataactttaag
gaaattaacgacgagtacgggcacctcgtgggagactgcatactcaagggaataggcgaa
atcctcaggaagtatttgagggcaaaagatgccatcggaaggtacggaggagatgagttt
ctaataatacttcccggtgtaaaactggaagatgctgtaaacatcgcaagacgcttaaaa
acggtcatacaaaaccataccttttactgtgaagataaggaattaaaagtttctgcgagt
tttggaattctggaagtcaacgaaaacttcaattccccggaagagatattaaaggaagta
gataaaaaactctacgaggcgaagaaaaaccccgaccacattgcttactaa

DBGET integrated database retrieval system