KEGG   Aquifex aeolicus: aq_689Help
Entry
aq_689            CDS       T00013                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
aae  Aquifex aeolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(468404..469414)
Genome map
AA seq 336 aa AA seqDB search
MEFKCRIHEKIREGEELNEVDKRNLKEVIKRMFNFFVEHNIVPVPRNYAKWFFVFCYIVE
NNIEATTEQIIDIYYKIFKEAKIDLRLSNEIERILTEVRHTVYEYLETVEKYDKKIEKHE
KTLEDYSRQEEISILKDILKEVSELRKVNQELIAKLQEKQKETERLKKELDALKKQAFID
YLTGLKNRRSIQKALEDYFKDYKNYGYPFSVIMMDLNNFKEINDEYGHLVGDCILKGIGE
ILRKYLRAKDAIGRYGGDEFLIILPGVKLEDAVNIARRLKTVIQNHTFYCEDKELKVSAS
FGILEVNENFNSPEEILKEVDKKLYEAKKNPDHIAY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaattcaagtgcaggatccatgagaaaataagggaaggggaagaattaaacgaagta
gataaaagaaacctgaaggaagtaataaagcgtatgtttaacttctttgttgagcataac
atagtccccgttccccggaactacgcgaagtggtttttcgtattttgctacatcgttgaa
aataacatagaggcaactacggagcaaataatagacatatactacaagattttcaaagaa
gctaaaatagacctgaggctttctaacgagatagaaagaattcttactgaagttagacac
acggtttacgagtatctggagacggttgaaaagtacgataaaaagatagaaaagcacgaa
aaaaccttggaagattactcaaggcaggaagaaattagcattttaaaggatattttgaaa
gaggtttccgaactgaggaaagtcaatcaagagttaatagcaaagcttcaagaaaaacaa
aaggaaacagaaagactcaaaaaagaacttgacgctttaaagaaacaggcttttatagat
tacctcaccggattaaaaaacaggcgttctattcagaaagctctggaggattacttcaag
gattataaaaactacggataccccttctccgtaataatgatggatttaaataactttaag
gaaattaacgacgagtacgggcacctcgtgggagactgcatactcaagggaataggcgaa
atcctcaggaagtatttgagggcaaaagatgccatcggaaggtacggaggagatgagttt
ctaataatacttcccggtgtaaaactggaagatgctgtaaacatcgcaagacgcttaaaa
acggtcatacaaaaccataccttttactgtgaagataaggaattaaaagtttctgcgagt
tttggaattctggaagtcaacgaaaacttcaattccccggaagagatattaaaggaagta
gataaaaaactctacgaggcgaagaaaaaccccgaccacattgcttactaa

DBGET integrated database retrieval system