KEGG   Aquifex aeolicus: aq_706Help
Entry
aq_706            CDS       T00013                                 

Gene name
trpB1
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aae  Aquifex aeolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    aq_706 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    aq_706 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    aq_706 (trpB1)
Enzymes [BR:aae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     aq_706 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482374..483567
Genome map
AA seq 397 aa AA seqDB search
MYNYPDERGYFGPFGGKFVPETLMYALEELEEKYRELKSDPEFQKELDYYLREYAGRPTP
LYFAEKLTKYVGGAKIYLKREDLLHTGAHKINNTIGQCLLTKRMGKKRVIAETGAGQHGV
ATATASALFGLECVVYMGEEDAERQALNVFRMKLLGAKVEIVKSGSRTLKDAINEALRDW
VTNVESTHYVIGSVVGPHPFPMIVRDFQSVIGRETKEQILQKEGRLPDAIVACVGGGSNA
MGIFYPFVEDKGVQLIGVEAGGYGLETGQHAASICGGSVGILHGMKSYFLQDEEGQIQPT
HSISAGLDYPGVGPEHALFHEIKRAKYTTATDEEALEGFKLLARTEGIIPALESAHAVIK
AVEVARELGKDGIVVINLSGRGDKDMAHVMKHLSLEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaactatccagacgagagaggttatttcgggcccttcgggggaaaattcgtcccc
gaaaccttgatgtacgccctggaagaacttgaagaaaaatacagggaattgaagagcgac
cctgaattccagaaagaactcgattactacctgagggagtacgccggaagacccactccc
ctttactttgcggagaaactaacgaagtacgtgggcggtgcgaagatatatctgaagagg
gaggatcttctccataccggtgcccataagataaacaacaccataggtcaatgtcttttg
accaagagaatgggaaagaaaagggttatagcggaaacgggggcgggacagcacggggtc
gcaaccgcaaccgcctcagcacttttcggcttggagtgcgtcgtttacatgggtgaagaa
gacgcggaaaggcaggctcttaacgttttcaggatgaaactcctcggagcaaaagtggaa
atagtaaagagcggaagcaggaccctaaaggatgccataaacgaagcactgagagactgg
gtgacaaacgttgaaagtacccactacgtgataggttctgtggttggtcctcatcctttt
cccatgatagtgagggattttcagagtgtaattggaagggagactaaggagcagatactg
cagaaggaaggaaggcttcccgacgctatagtcgcgtgcgtgggaggcggttcaaacgct
atggggatattctaccccttcgttgaagacaaaggagttcagctaataggcgtggaagcg
ggaggatacggactggaaactggacagcacgctgcttccatatgcgggggaagtgtagga
atccttcacggtatgaagagttacttccttcaggacgaggaaggacaaattcagccaact
cactccatttcagctggactagactacccaggagttggacccgaacacgctctctttcac
gagataaaacgggcaaagtacaccacagcaaccgatgaggaggcgcttgaaggtttcaaa
ctcctcgcacgtacggaaggtataatccctgccctcgaaagtgcccacgcggtaataaag
gcggttgaagtggcaagagaattgggaaaggacgggatagttgttattaacctctcagga
aggggagacaaggatatggcacacgttatgaaacacctttcactcgaaggctaa

DBGET integrated database retrieval system