KEGG   Aquifex aeolicus: aq_723Help
Entry
aq_723            CDS       T00013                                 

Gene name
malM
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aae  Aquifex aeolicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    aq_723 (malM)
Enzymes [BR:aae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     aq_723 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
500632..502089
Genome map
AA seq 485 aa AA seqDB search
MRLAGILLHVTSLPSPYGIGDLGKEAYRFLDFLKECGFSLWQVLPLNPTSLEAGNSPYSS
NSLFAGNYVLIDPEELLEEDLIKERDLKRFPLGEALYEVVYEYKKELLEKAFKNFRRFEL
LEDFLKEHSYWLRDYALYMAIKEEEGKEWYEWDEELKRREKEALKRVLNKLKGRFYFHVF
VQFVFFKQWEKLRRYARERGISIVGDLPMYPSYSSADVWTNPELFKLDGDLKPLFVAGVP
PDFFSKTGQLWGNPVYNWEEHEKEGFRWWIRRVHHNLKLFDFLRLDHFRGFEAYWEVPYG
EETAVNGRWVKAPGKTLFKKLLSYFPKNPFIAEDLGFITDEVRYLRETFKIPGSRVIEFA
FYDKESEHLPHNVEENNVYYTSTHDLPPIRGWFENLGEESRKRLFEYLGREIKEEKVNEE
LIRLVLISRAKFAIIQMQDLLNLGNEARMNYPGRPFGNWRWRIKEDYTQKKEFIKKLLGI
YGREV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagattggcaggtattttacttcacgtaacttcacttccctctccttacgggataggg
gatctcggaaaagaagcctacaggtttctggacttcttaaaggagtgcggttttagcctt
tggcaggttctacctctgaaccccacttcacttgaggcgggaaactcaccctacagttca
aactccctcttcgcgggcaattacgtactaatagaccctgaagaattattggaggaggac
ttaataaaagaaagggacttaaaaagatttcccttgggtgaagccctttacgaagtcgtg
tacgagtataaaaaagagttgctcgaaaaagcctttaaaaatttcaggagatttgaactg
cttgaagattttctgaaggaacactcttactggctcagagattacgcactttacatggct
ataaaagaagaagagggaaaggagtggtatgaatgggatgaagaattgaagaggagagaa
aaagaggctttaaaaagggtgttaaataagttaaaggggaggttttacttccacgtattc
gtccagtttgttttcttcaagcagtgggaaaaactgagaagatacgcaagggaaaggggg
ataagcatagttggagatcttccaatgtacccctcgtactcaagtgcggacgtgtggaca
aatcctgaactttttaaactggacggagatttaaaacccctttttgtagcgggtgttcct
cctgattttttcagtaaaacgggacagctgtggggaaatcccgtttacaactgggaagaa
cacgaaaaggaaggcttcagatggtggataaggagagttcatcacaacttaaaactcttt
gactttttaagacttgaccacttcaggggatttgaggcgtactgggaggttccttacggt
gaagaaactgcggtaaacggaaggtgggtaaaggctcccggaaagacactatttaaaaaa
ctcttatcatacttcccgaagaacccattcatagcggaggacttaggttttataacggac
gaagtgaggtacttgagggaaacttttaaaatcccgggaagcagagttattgagtttgcc
ttctacgataaggaaagtgagcaccttccccacaacgttgaagagaacaacgtttactac
acttcaactcatgaccttcctccgataagaggatggtttgagaatttaggagaagaatca
agaaaacgattatttgaatacttgggaagggagattaaagaggaaaaagttaacgaggag
cttataagactcgttttaatctcaagggcgaagttcgcaataatccagatgcaggactta
ctcaatctcggcaatgaagcgaggatgaattaccccggaagacctttcggaaattggagg
tggagaataaaggaagattacacacaaaagaaggaatttattaaaaaactcctcggaatt
tacggaagagaagtttaa

DBGET integrated database retrieval system