KEGG   Aquifex aeolicus: aq_782Help
Entry
aq_782            CDS       T00013                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aae  Aquifex aeolicus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aae01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aae00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(539585..540865)
Genome map
AA seq 426 aa AA seqDB search
MRIEDLRKEDWKLNERLEYLAKRGEILEEEYEKSVKEILKRVREEGDRAVIEFTKKFDGV
ELTPENMEVPFEELEKAYEEIEPEVREALEFAENRIRVFHEKQLENSFFKEEEGIILGQK
VVPLEKVGVYVPGGKAAYPSTVLMNVVPASVAGVEEIIMVSPKPNKYTLAAAYIAGVSRV
FQVGGAQAIGALAYGTEKIPKVDKIVGPGNIYVALAKKLVFGTVDIDMIAGPSEVLVIAD
ERANPTWVAADMLSQAEHDELAASILLTPSEELANKVKEEVERLLSQLERKEIAQKSLEK
FGTIFLVKDLYHACEVANYIAPEHLEVMVREPMALLPELKHAGAIFLGDYTTEPLGDYVL
GPNHTLPTGGSTRFFSPLGVYDFIKRSSVLYVSREGFKRVANQAEAIAKAEGLTAHALAV
KVRKND
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgaggacctgagaaaggaagactggaaactcaacgagaggcttgagtacctc
gcaaagaggggagagatactggaagaggagtacgaaaagagcgtaaaggaaattctgaaa
agggtaagggaagagggggacagggctgttatagagttcacgaaaaagtttgacggagta
gaattgacacccgagaacatggaagttccctttgaggaacttgaaaaagcttacgaagaa
atagaacctgaagtgagggaagcccttgagtttgcagaaaacaggatcagggtattccac
gaaaaacaattggaaaactccttcttcaaagaagaggaggggataatactcggtcagaag
gtagttcctttagaaaaagtgggcgtttacgttcccggcgggaaagcagcttacccctca
acagttttaatgaacgtggtgcccgcatccgtggcgggagtggaagaaataataatggtg
tcaccaaaaccgaacaagtacaccttagcagcagcatacatagcgggagtgagcagggtt
tttcaggtcggcggagctcaggcgataggtgcactagcttacggaacggagaaaatacct
aaggttgacaagatagtgggtccgggaaatatatacgtggcgcttgcgaaaaaactcgtc
tttgggaccgttgacatagacatgattgcaggaccttccgaagtcctcgttatagccgac
gaaagggcaaaccccacttgggtagccgcggacatgctctctcaggcggagcacgacgaa
ctcgcggcgtccatacttctcactccctccgaagagcttgcaaataaggtaaaggaagaa
gtggaaagacttctttctcaattagaaagaaaggaaatagctcaaaaatccctagagaaa
ttcggaacaatctttctggtgaaggacctttaccacgcctgcgaggttgccaattacata
gctccagaacaccttgaagtcatggtaagggaacccatggcgctccttccggagctaaaa
cacgcgggagcaatttttctcggagactacaccactgaacccttgggtgattacgtcctc
ggtccaaaccacacacttccaacaggtggtagtacaaggtttttctcccctctcggagtt
tacgactttataaagaggtcctccgttctctacgtctccagagaaggcttcaaaagggtg
gcaaatcaggcggaggcaatagcgaaagcggaaggactcactgcccatgcccttgcggtg
aaagtgaggaaaaatgattag

DBGET integrated database retrieval system