KEGG   Aquifex aeolicus: aq_915Help
Entry
aq_915            CDS       T00013                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aae  Aquifex aeolicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    aq_915
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     aq_915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
630432..631238
Genome map
AA seq 268 aa AA seqDB search
MIKVLSPAKINLGLWVLGRLPSGYHEILTLYQEIPFYDEIYIREGVLRVETNIGIPQEEN
LVYKGLREFERITGIEINYSIFIQKNIPPGAGLGGGSSNLAVVLKKVNELLGSPLSEEEL
RELVGSISADAPFFLLGKSAIGRGKGEVLEPVETEISGKITLVIPQVSSSTGRVYSSLRE
EHFVTPEYAEEKIQRIISGEVEEIENVLGDIARELYPEINEVYRFVEYLGFKPFVSGSGS
TVYFFGGASEELKKAAKMRGWKVVELEL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggttctatcacccgcgaagataaacttggggctgtgggttctggggaggcta
ccgagtggttaccacgagatacttaccctctaccaggaaatccccttttacgatgagatt
tacataagggagggagtgctcagggtagagacgaatataggcattcctcaggaggagaac
ttagtttacaaaggattgagggaatttgaaaggataacagggattgaaattaattactct
atctttattcagaagaatataccacccggtgcgggactcggaggaggaagctcaaatctg
gcggtagttctaaaaaaggtaaacgaactcttaggatctcccttatctgaggaagaactg
agggaacttgtaggcagtatttccgcagacgctccctttttccttctcggaaagagcgct
atcggaaggggaaaaggggaagttcttgaacccgtggaaactgaaatttcgggtaaaatc
acactagtaatccctcaagtctcttcaagcacgggaagggtttactcttccttgagggaa
gaacacttcgttacaccagagtacgcggaagaaaaaattcaaagaatcatctcgggagag
gttgaggaaatagaaaacgtcctcggagatatagcgagggaactttacccggaaataaac
gaggtttacaggtttgttgagtatttgggattcaagccttttgtgagcgggagcggttca
acggtttacttcttcggaggggcatcggaagagttaaaaaaagctgcaaagatgaggggc
tggaaagttgtagagctagaactctaa

DBGET integrated database retrieval system