KEGG   Aquifex aeolicus: aq_915Help
Entry
aq_915            CDS       T00013                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aae  Aquifex aeolicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:aae00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
630432..631238
Genome map
AA seq 268 aa AA seqDB search
MIKVLSPAKINLGLWVLGRLPSGYHEILTLYQEIPFYDEIYIREGVLRVETNIGIPQEEN
LVYKGLREFERITGIEINYSIFIQKNIPPGAGLGGGSSNLAVVLKKVNELLGSPLSEEEL
RELVGSISADAPFFLLGKSAIGRGKGEVLEPVETEISGKITLVIPQVSSSTGRVYSSLRE
EHFVTPEYAEEKIQRIISGEVEEIENVLGDIARELYPEINEVYRFVEYLGFKPFVSGSGS
TVYFFGGASEELKKAAKMRGWKVVELEL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggttctatcacccgcgaagataaacttggggctgtgggttctggggaggcta
ccgagtggttaccacgagatacttaccctctaccaggaaatccccttttacgatgagatt
tacataagggagggagtgctcagggtagagacgaatataggcattcctcaggaggagaac
ttagtttacaaaggattgagggaatttgaaaggataacagggattgaaattaattactct
atctttattcagaagaatataccacccggtgcgggactcggaggaggaagctcaaatctg
gcggtagttctaaaaaaggtaaacgaactcttaggatctcccttatctgaggaagaactg
agggaacttgtaggcagtatttccgcagacgctccctttttccttctcggaaagagcgct
atcggaaggggaaaaggggaagttcttgaacccgtggaaactgaaatttcgggtaaaatc
acactagtaatccctcaagtctcttcaagcacgggaagggtttactcttccttgagggaa
gaacacttcgttacaccagagtacgcggaagaaaaaattcaaagaatcatctcgggagag
gttgaggaaatagaaaacgtcctcggagatatagcgagggaactttacccggaaataaac
gaggtttacaggtttgttgagtatttgggattcaagccttttgtgagcgggagcggttca
acggtttacttcttcggaggggcatcggaagagttaaaaaaagctgcaaagatgaggggc
tggaaagttgtagagctagaactctaa

DBGET integrated database retrieval system