KEGG   Aquifex aeolicus: aq_994Help
Entry
aq_994            CDS       T00013                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aae  Aquifex aeolicus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:aae00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
686941..687537
Genome map
AA seq 198 aa AA seqDB search
MKVKLTDRDALIVVDMQKDFMPGGALPVPEGDKIIPRINEYVKLFEKKGLPVFYTRDWHP
ENHISFKGHGGIWPPHCVQGTEGAKFHEDLYIPADNKFIISKGTSQEFDAYSGFQGTILN
DLLKERGVRRIFVCGVATDYCVKNTTIGGINLGYQAFVLEDAIKGVDVNPGDVERAINEM
MERGAAFIKIEDIVDYKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaagttaaccgatagagacgcccttatagtcgttgatatgcaaaaggacttt
atgcccggtggtgcactacccgttccagagggagacaagataataccgaggataaacgag
tacgtcaaactctttgaaaagaaaggacttcctgttttctacacgagggactggcaccca
gaaaatcacatatccttcaaaggacacggcggtatatggccacctcactgtgttcaggga
acggaaggtgctaagttccacgaagacctgtacatccccgcggacaacaagttcataatt
tcaaagggaacttctcaggagtttgacgcgtattccggttttcagggaacgattttaaat
gaccttttgaaagagaggggagtaagaaggatattcgtgtgcggagtggcaacggattac
tgcgttaaaaacacaacgataggcggtataaacctcggctaccaggcctttgttctggaa
gatgcgataaagggcgtggacgtgaaccccggagacgttgagagagcaataaacgagatg
atggaaaggggagctgcctttataaagattgaagatatagtagattacaaaaagtaa

DBGET integrated database retrieval system