KEGG   Aedes aegypti (yellow fever mosquito): 5569749Help
Entry
5569749           CDS       T01053                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X2
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     5569749
Peptidases [BR:aag01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   5569749
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   5569749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 403 aa AA seqDB search
MPYFAMQRRPILLKICLTTCKICILVFVIIFIVLPLIFKFSFALQKSILFLTFISYPPNL
DLKRPEKSGLYATRNFFVTYRDQEEDIDVDVAVWHVLPNDLVRRFAKELQIDEPTLSNMT
APEDVREKVDAIATKDSSQYREIERILHRPNLNLDDSATQKDLFEETLRATTNDIVLYLH
GNTASRGASHRVDLYKLLRSLNYHVVTLDYRGYGDSANISPTERGVVYDALAVYQYITSI
SKNPVYLWGHSLGTGVATHLLSLLTDMSLPGPKAVVLESPFNNIREEICAHPFSKLYRHL
PWFDYTISSPMYANELRFESDQHIAEFRQPVLILHAEDDHVVPFNLGYKLYRTALDTRGK
SWGPIEFHRFEKTSHYGHRYICRAPNLPEIVIHFFRTYRNEQY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccctattttgcgatgcaaagaaggcccattctactgaaaatctgtttgacgacgtgc
aaaatctgcatcctggtgttcgtgatcatcttcattgtgttgccactgatattcaaattc
tcgtttgccctgcagaagagcatcctgtttctgacgtttatctcctatccgccaaatctt
gatctcaaacgtccggagaagagcggactgtacgcgacgcgtaactttttcgtcacctac
cgggaccaagaagaggacatcgatgtggatgtcgcggtgtggcacgtgcttcccaatgat
ctggttcgccggttcgccaaagaactgcaaattgatgagcctactctatccaacatgacc
gccccggaggatgtccgagagaaggtggacgcaatagctaccaaagattcgtcgcaatat
cgggaaatcgagcgaattctacaccgcccgaacctgaacctggacgatagtgccacccag
aaagacctgttcgaggagaccctacgggccaccaccaatgatattgtactttatctccac
gggaacactgcctcacggggggcttcacatcgagtggatttgtataaactgctgcgcagc
ttgaattaccacgtggtgaccctagattaccgagggtacggtgattcggccaacatctcc
ccaactgagcggggagtggtgtacgatgccctggccgtatatcagtatattaccagtatt
agtaagaatccagtttacctgtggggccattcgctggggacaggtgtggccacacatttg
ctgtccctgttgactgacatgagcttgccaggaccgaaagcagtcgttttggaaagcccc
ttcaacaatatccgggaggaaatttgtgctcatccgttctctaagttgtatcgacatctt
ccctggtttgattacaccatttcgagtcccatgtatgccaatgagttgcgtttcgagtcg
gatcagcacattgccgagttcaggcagccggtgttgattctgcatgccgaggatgatcac
gtcgttccgttcaacctaggttataagctctaccgcaccgccctggacactcgcggaaaa
tcgtggggccccatcgagttccatcggttcgagaagaccagccactacggccaccggtac
atctgccgggcaccgaacttgccggagattgtgatccacttcttccgcacgtaccgcaac
gaacagtactga

DBGET integrated database retrieval system