KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000213Help
Entry
AaeL_AAEL000213   CDS       T01053                                 

Definition
d-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AaeL_AAEL000213
   00330 Arginine and proline metabolism
    AaeL_AAEL000213
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    AaeL_AAEL000213
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AaeL_AAEL000213
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AaeL_AAEL000213
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     AaeL_AAEL000213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 345 aa AA seqDB search
MKQIVVLGAGVNGLSAAVQLAEYYYNVAKVTLISEDVTPNTTGDVSAGLWGPYYCGKTPD
HKIVKWSADTHVFFHQLWKNGLASPLGISLQPCTRLTTDPNGYPEPSWKDIVFGCVKLSQ
KELERLSYEHGRNYTGGYHFATFTCQPMGLLPYLFNRFINVGGEFVQAKVNSIESILSGR
KVDLIVNCTGLGSMNMLGDKEMLPIRGQIARVCAPWVFEIILDDSDDGNYVIPNTETVIL
GGTHQMNDFNRNVNKDDSKFIFDGCERMLPSLKNAKLVQEQVGLRPGRSTVRLELEHYKA
GNLTVPVIHNYGHGGCGVTLAWGCGAEVLEISQKLDLDVDSKSKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattgttgttctcggagccggagttaacgggctaagtgcggccgtccagttg
gctgagtattactataatgtggccaaagtgacgctgatttctgaggacgtgactcccaac
acaaccggtgatgtctcggcggggctgtggggtccttactattgtggcaaaactccggat
cataaaattgtaaaatggtccgcagatacacatgtcttcttccaccagctatggaagaac
ggactagcctcccctctcggaatcagcctgcagccctgcaccagactcacaacggatccc
aatggctacccggaaccctcctggaaggacatcgtcttcgggtgcgtcaaactgtcccag
aaagagctggaacgattaagctacgagcacggtcgaaactacaccggtggttaccatttc
gcgaccttcacgtgccaaccgatgggactgctgccgtatctgttcaaccggttcatcaac
gtgggcggagagttcgtccaggccaaggtgaacagtatcgaaagtattctgagcggccgg
aaggtggacttgatcgtcaactgtaccggactgggctcgatgaacatgttgggcgacaag
gaaatgctgcccattcggggacaaattgcgcgcgtttgtgcaccgtgggtgttcgagatc
atcctggacgatagcgacgacgggaattatgtgattccgaacaccgaaaccgtgatactg
ggtggaacccaccaaatgaacgatttcaatcgaaacgtgaataaagatgacagcaaattt
atcttcgatggatgcgaacgaatgctgccaagtctgaagaatgcaaagttggtgcaggag
caggttggcttgcggcccggtcgcagtactgttcggctggaattggagcactacaaagca
ggtaatttaactgtgccagtcatccacaattacggccatggcggatgtggtgtaacgcta
gcgtggggatgcggagcagaagtcttggagatcagccaaaaacttgacttggatgtggat
tccaaatccaaactgtaa

DBGET integrated database retrieval system