KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000222Help
Entry
AaeL_AAEL000222   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL000222
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C86
   AaeL_AAEL000222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 177 aa AA seqDB search
MFKIKFPLISWPRLLVDKECYNKVQLDTICRNLAPNDYINPHRSILGLGNYDINVIITAL
HMKDCEAVWFDKRKDPCCIDTSKIVGFILNVPSNYKIGFVRLPIQRRHWISVRKINGQYW
NLDSKLDAPQAIGDEIQTMEYLRTQLQSNDKELFIVCTKGVDNDQSWLLPEYRRDGI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaatcaaatttccactcatttcctggcccaggctgctagttgataaagaatgt
tacaataaagttcaactggacacaatttgtcgcaatttagctccaaacgattacataaat
cctcatagatcgattttaggcctgggaaattatgatataaatgttattataacagcactg
cacatgaaagattgtgaagctgtttggttcgataagagaaaggacccttgttgcatcgat
acctcaaaaatagttggttttattctgaacgttccatcaaactacaagattggatttgtt
agactgccaatccaacggaggcattggatcagtgtgcggaagatcaatggtcaatattgg
aatctggattcgaaactagatgccccacaagctataggagacgaaattcaaaccatggaa
tatctacgtactcaactgcaaagcaacgataaagaactgttcattgtttgtactaaggga
gttgataatgatcagagctggctgcttccagagtacagacgagatggcatataa

DBGET integrated database retrieval system