KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000321Help
Entry
AaeL_AAEL000321   CDS       T01053                                 

Definition
acetyl-coa synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL000321
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL000321
   00620 Pyruvate metabolism
    AaeL_AAEL000321
   00640 Propanoate metabolism
    AaeL_AAEL000321
Enzymes [BR:aag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AaeL_AAEL000321
Lipid biosynthesis proteins [BR:aag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AaeL_AAEL000321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 668 aa AA seqDB search
MPSEPKVFNPHPDVADKAYINSMEQYQEFYRQSIENPGQFWSNVAKQFHWETPYDPKNFF
SYNFDISKGPIFVKWMEGASTNICYNLLDRNVKNGLGDTVAYYWEGNHPDDYSRLTYRKL
LEEVCRFANVLKAHGVQKGDRVSIYMPMTMELPVAMLACARIGAVHSIVFAGFSSDSLAE
RMHDCQAKVLITADGAWRGEKILHLKDLCDQALIKADEMGHHVETCIVVAHINRVTPGKP
DWDGVFDTPWTDDRDYWWHQEMEDAEPACYPEWMAAEDPLFMLYTSGSTGKPKGVLHTTA
GYLMYAATTFKIVFDYKPHDVYWCTADIGWITGHTYVLYGPLANGATSVMFEGTPFFPDN
DRYWEVVDKYKVTQFYTAPTAIRSLMKYGDEPVMKHDLSSLRVLGSVGEPINPEAWMWYY
KVVGKEKCAIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDESGNEIKGE
GEGYLVFSQPWPGMMRTLFNNHPRYESTYFSKFNGFYCTGDGARRDADGYYWITGRVDDM
LNVSGHLMSTAEVESVLTEHSRVSEAAVVSRPHPVKGECLYCFITPNQNEAFDKTLINEL
KILVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKVAINDREVGDTSTLADEAIIEQ
LFANRPVA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggaaccgaaggttttcaacccgcaccccgatgtcgccgacaaggcgtacatt
aacagcatggaacagtaccaggaattttatcggcagtccatcgaaaatccggggcagttc
tggagcaatgtagcgaagcagttccactgggagactccttatgatccgaagaacttcttc
tcgtacaacttcgatatctccaagggcccaatctttgtgaagtggatggaaggtgcctcg
accaatatctgctacaacttgctggatcgaaatgttaagaatggcctgggtgatactgtg
gcctattactgggaaggaaaccacccggatgactacagtcgcctcacgtaccgcaagctg
ctcgaagaggtatgccgctttgccaacgtcctgaaggcccatggcgtccagaagggcgat
cgcgtgtcgatctacatgcccatgacgatggaactgccggttgcgatgttggcctgcgct
cggatcggtgccgtgcactcgattgtgtttgcaggtttctcatcggattcgttagctgag
cggatgcacgattgccaagcgaaggtactgatcaccgccgatggagcctggcgtggggag
aaaatccttcatctgaaggatttgtgcgatcaggcgctgatcaaggccgatgaaatggga
caccatgttgagacctgtatcgttgtggcgcacattaatcgagtaactcccggtaaacct
gactgggatggagtgttcgatactccgtggacggacgatcgcgattattggtggcatcaa
gaaatggaagatgctgaaccggcctgctatcccgagtggatggcagcggaggatccgctg
ttcatgttgtataccagtggatcaacgggcaagccgaagggcgttctacacactacagct
ggatatctgatgtacgcggcgacgaccttcaaaattgtgttcgactacaagccccatgac
gtgtattggtgcactgctgatattggttggatcaccggccatacctacgtgctgtatgga
ccgctggcaaacggtgcaacgtcggtgatgttcgagggtactccgttctttccggataac
gatcgctactgggaagtggtggacaagtacaaggttacgcagttctacacggcaccgacg
gcgatacgatcgctgatgaagtacggcgacgagcctgtgatgaaacatgatctttcttcg
ttgagggtactcggaagtgtcggtgaaccgatcaaccccgaagcgtggatgtggtactac
aaagtagtaggcaaggagaagtgtgctattgtggatacgttctggcagacggaaactgga
ggacatgtgataactccgctaccgggagctactccaatgaagccaggatcagcttctttc
ccattcttcggagtgaaaccgactcttctagacgaaagtggcaacgaaatcaagggcgaa
ggagaaggttatctggttttctcgcagccatggcccggaatgatgcgaacactgttcaac
aaccacccacgatatgagtccacgtatttctccaagttcaatggcttttattgcactgga
gatggtgctcgacgagatgccgacggatactactggatcacaggccgcgtggacgacatg
ctcaacgtttccggccatctgatgtctaccgctgaagttgaatccgtactaaccgagcat
tctcgcgtatcggaagctgctgttgtgtcacgacctcaccccgttaaaggcgagtgcctg
tactgtttcatcacccccaaccagaacgaagccttcgacaagacgcttatcaacgaattg
aagatattggttagggaacgcattggcccatttgcccagccggacgtaatccagcatgcc
ccaggactcccaaagacacgatccggcaagatcatgcgacgtgtgctgcgaaaagttgcg
atcaacgatcgggaggtcggagacacttcaacacttgccgacgaagcgatcattgagcag
ctcttcgccaaccgaccggtagcttaa

DBGET integrated database retrieval system