KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000448Help
Entry
AaeL_AAEL000448   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL000448
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   AaeL_AAEL000448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 628 aa AA seqDB search
MTIKPVINQQSSDDGQEGTTSQNLVQNGTVVGRNTHRNVVLNQLSTSESQPLPREKRVHT
PHNFDSENVRHRRSPHKNLGRTKRDHHHKRENRERDKNPSPSYPPVLPTVNNKKQAAPSC
SSPMGNAGGRSPMSTIPSSSNLNVVATGSNSNNSINLKAAIEEALSGYNSGDEHVGQKDA
QLTPDEWKKRDDAFVKIMSERGFVIKDMVEDGACLFRAISMQIFGDQDMHEMIRQQTMDY
IYQNREYFAQFVTEDINSYVTRKRANHVHGNHIEIQAMSEMYNRSVELYCYQLEPINIFN
SEQLNNGNEPLRLSYQRCSHYNAILDPYKASVGVGLGLAGYRPDELDIKQMADAVRMSEE
LEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRDNMRKNSGKNSKSTSTITSSDL
GGGGGGGAGGCCSTSVSPEKSPKQNLEAATSYSESLLREFRKSSSPSPSNHSFNQGSCSS
SSKNSSFELDCSPPETSCSVQYYFNSSNRRKKRNLNSPVDKPSTELLPKKSKLVSNPPVE
HEANSGASTSGTGKNDNRPREEPVSEFYQSLLESSYTDDGFAQLTEREMIQKALAESAMD
FVKRSDRTKGSQEDKYGTTDEEYDSPSP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaaccggtgataaatcagcaaagttcggacgatggccaagagggcaccact
tcccagaatctggtccaaaatggaaccgtggtggggcggaacactcatcggaatgttgtc
ctgaatcagctgtcgacgtccgaaagtcaaccactccccagggaaaaacgggttcacact
ccgcacaattttgactccgaaaatgttcgccacaggaggagcccccacaaaaaccttggc
cgcaccaaacgagatcatcatcacaagagagaaaatcgcgagcgggacaaaaacccatcg
ccaagctatccacctgtgttaccaacagtgaacaacaagaaacaagctgcaccatcatgt
tccagtccgatgggaaatgccggtggccggtccccgatgagtacaatcccttcaagcagc
aacctgaatgtggtggcaacgggcagcaacagcaacaactcgatcaacttgaaagctgcg
attgaggaagctctatccggatacaacagtggagacgaacatgtcggccagaaggatgcc
cagctgactcccgacgagtggaaaaagcgtgatgatgccttcgtcaaaattatgtccgag
cgaggattcgtcataaaggacatggttgaggatggtgcatgtttgttcagggccatttcc
atgcaaatcttcggcgatcaagacatgcacgaaatgattcggcaacaaaccatggattac
atataccaaaatcgagaatattttgcacaattcgtaacggaagatatcaacagctatgtg
accaggaagcgggcgaaccacgttcatggaaatcatattgagattcaagcaatgtcggaa
atgtacaaccgctcggtggaattgtattgttatcagttagaaccaatcaacattttcaat
tccgagcaactgaacaacggaaatgagccgctacggttgtcgtatcaacggtgttcgcac
tacaatgcaatattagatccgtacaaagcctccgtcggtgtcggattaggtttagcagga
tataggcctgacgaattagacatcaagcaaatggcagatgcagtccgaatgagcgaagag
ctagaaatcgagcaaactatgtttgaggataagctgaaaaccactgactgggaagctacg
aatgaagcaatcgaagagcagatagcgagggaatcgtacttgcagtggtgtcgtgataat
atgcgtaagaactccggtaagaacagcaaaagcaccagcacaattacctctagtgatctt
ggtggcggcggcggcggaggcgctggtggatgctgtagcacttctgtgagtccggagaaa
tcgccgaagcaaaacctggaagctgctacgtcgtactcagagtcgcttctgcgcgaattt
cggaaatcgtcgtctccatcgccatcgaatcattctttcaaccaaggaagctgttcgtca
agctcgaaaaacagctccttcgaattggattgttcccccccggagacttcttgttcggtt
caatattacttcaacagcagtaatagaagaaagaaacgcaatttgaactctccggtggac
aaacccagcacagaattactaccaaaaaaatctaaattagtatccaatcctccggtggaa
cacgaagctaatagtggtgcaagcacatcgggaactggcaaaaacgataaccgcccgcgg
gaagaaccggtttcggagttttaccaatctttgctggaatcatcgtacacggatgatggc
tttgcacaactaaccgagcgagaaatgatccagaaggccctggccgagtcagcgatggac
ttcgtcaaaaggagcgaccgaacgaaaggctcccaggaggataaatatggtacaaccgat
gaggaatacgattcgccttcgccgtaa

DBGET integrated database retrieval system