KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000452Help
Entry
AaeL_AAEL000452   CDS       T01053                                 

Definition
histone acetyltransferase gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:aag04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 761 aa AA seqDB search
MNDHSKHSVEVKTEKQDDRSAGSGNGGGGGGSQEATRQDSIERILQRKQRVYQLPKNQKL
TKLSMYSACQGTECRCTGWKTPEENRHKDVEVDYCPNFKEECRNPNCKHPLDMHIAHLGE
ISEDQINELLGAIVDVENLYMSMLRETDTDTKKVYAYLFRLLRQCILTRSQPVIRGPLGD
PPFEQPSISKAVTNFVLFKYSHLNPGELETMTEVAKTFLHCLNHWNFEAPSARKDLSHED
ASNYKINYTRWLVFCHVPAFCSSLRHFETSIVFGRTLLKAVYQYVYQQLLTKCKTERDRM
PPEKRLMLAQLPKFLEALKHEVINEESQIWDQNFKPTASLMLQKKRQHEAATSSSAKKSN
DAKRYKKDSDCEDLPDDVVIKALKRLNDSNYTSRTEVVFPPNAPRDEAAKAEENRREIEF
HVVGNSLTKPVTKESMLWLLGLHSVFAHQLPGMPREYISQLVFDPKHKTLALVKDGRPIG
GICFRTFATQGFTEIVFCAVTSSEQVKGYGTHLMNHLKDYSTQRGIKHFLTYADEFAIGY
FKKQGFSKDIKVARHVYAGYIKEYEGATLMHCELHPSLIYTQFSSVIRKQKEIVKELIAQ
RQQEVQKVHPGLTCFKEGLRSIPIESIPGLREVGWRPQFRTQRTSRPLEESADPDKLSNA
LTGVLQSVRQHSAAWPFLKPVNPAEVPDYYDHIKYPMDLKTMGERLKNKYYISRRLFMAD
MARIFTNCRLYNSPETEYFRCANTLERYFQTKMKEIGLWDK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccattcgaaacattcggtcgaagtgaaaaccgagaagcaagatgatcgttcc
gccggaagtggaaatggtggtggaggtggcggatcacaagaggcaacccgccaggacagc
atcgagaggattttgcagcggaagcaaagggtttaccagctgccgaaaaatcagaagctg
accaagctgtcgatgtattcggcctgtcaaggaacggagtgccggtgcacgggctggaag
accccggaggagaatcgacacaaggatgtcgaagtggattactgtcccaacttcaaggag
gaatgccggaatccgaactgcaagcatcccctcgatatgcacattgcccatttgggagag
atcagcgaggaccagattaatgaactgttgggagcgatcgtcgatgtggagaatctttat
atgagtatgctgcgggagaccgacaccgacacgaagaaagtctatgcgtacctttttcgg
cttttaagacaatgcattctgacgagatctcagcccgtgatccgtggcccgctgggtgac
cctcccttcgagcaaccatccatttcgaaagcggtgacaaactttgtcctgttcaaatac
agtcatctgaatccgggcgagctggaaacgatgaccgaggtagcgaagacctttctccat
tgtttgaatcattggaattttgaagccccgagtgcgcgcaaagatctgagccatgaagat
gcttccaactacaaaatcaattacactcgctggttggtgttctgccatgttccggcattc
tgcagctccctgcgtcatttcgaaacttcaattgtgtttggccggacacttttgaaggca
gtttatcagtacgtttaccagcagctgctgaccaagtgcaaaaccgaacgggacagaatg
cccccggagaagcgtctcatgctggctcagctgcccaagtttcttgaagcgttgaagcat
gaggtcatcaacgaagaatctcaaatatgggaccagaacttcaaaccgactgcatcgttg
atgctacagaagaaacggcaacacgaagcggccacgtcctctagtgctaagaagtccaac
gacgccaagcgatacaagaaggactccgactgcgaagatcttccggacgatgtggtcatt
aaagcgctgaaaagactcaacgattccaattacaccagccgaacggaggttgtgttccct
ccgaatgccccgagagatgaagcggccaaggcggaggaaaatcgtcgggaaatcgagttc
catgtggtgggcaattcgctgaccaagccggtcaccaaggagtccatgctttggctgttg
ggtttgcacagcgtgtttgctcatcagctgccgggaatgccgagggagtacatcagtcag
ctggtgtttgatccaaaacacaaaaccctagcgctggtcaaggacggccgtccaatcggt
ggaatctgcttccgcacgttcgcaacgcaagggttcaccgagattgtgttctgtgcagtc
acgagcagcgagcaagtcaagggctacggaacccatttgatgaaccacctgaaggactac
agcacacagcgaggcatcaagcacttcctgacctacgccgacgaatttgcaatcggatat
ttcaagaagcagggtttctccaaagacattaaagtggcgcgtcatgtctatgctggttac
attaaagagtacgaaggagcaacgcttatgcattgtgaactgcatcccagcctgatttac
actcaattcagctcggtaattcggaagcagaaagagattgtaaaagagctgattgctcaa
cgtcagcaagaggttcagaaggttcatcctgggttaacgtgtttcaaagaaggcctccgt
agcattcccatcgagtccattccgggtttgcgcgaagtcggatggagaccgcagtttcgc
acccagcgcacctctcgtccactggaggaatcagccgatccggataagctgtcgaacgcc
ctgaccggtgtgctccaatccgttcggcaacattcggcagcttggccgttcttgaagccg
gtgaaccccgccgaagtgccggactactacgaccacatcaagtacccgatggacttgaaa
actatgggcgaacgactgaagaataagtattacatttcgcgacggctatttatggcagac
atggcgcgcattttcacaaactgtcgattgtataattcgcctgagactgaatactttcgt
tgcgccaacactctggagcggtatttccagaccaagatgaaggaaatcggactatgggat
aaatga

DBGET integrated database retrieval system