KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000452Help
Entry
AaeL_AAEL000452   CDS       T01053                                 

Definition
histone acetyltransferase gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    AaeL_AAEL000452
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL000452
Transcription machinery [BR:aag03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AaeL_AAEL000452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 761 aa AA seqDB search
MNDHSKHSVEVKTEKQDDRSAGSGNGGGGGGSQEATRQDSIERILQRKQRVYQLPKNQKL
TKLSMYSACQGTECRCTGWKTPEENRHKDVEVDYCPNFKEECRNPNCKHPLDMHIAHLGE
ISEDQINELLGAIVDVENLYMSMLRETDTDTKKVYAYLFRLLRQCILTRSQPVIRGPLGD
PPFEQPSISKAVTNFVLFKYSHLNPGELETMTEVAKTFLHCLNHWNFEAPSARKDLSHED
ASNYKINYTRWLVFCHVPAFCSSLRHFETSIVFGRTLLKAVYQYVYQQLLTKCKTERDRM
PPEKRLMLAQLPKFLEALKHEVINEESQIWDQNFKPTASLMLQKKRQHEAATSSSAKKSN
DAKRYKKDSDCEDLPDDVVIKALKRLNDSNYTSRTEVVFPPNAPRDEAAKAEENRREIEF
HVVGNSLTKPVTKESMLWLLGLHSVFAHQLPGMPREYISQLVFDPKHKTLALVKDGRPIG
GICFRTFATQGFTEIVFCAVTSSEQVKGYGTHLMNHLKDYSTQRGIKHFLTYADEFAIGY
FKKQGFSKDIKVARHVYAGYIKEYEGATLMHCELHPSLIYTQFSSVIRKQKEIVKELIAQ
RQQEVQKVHPGLTCFKEGLRSIPIESIPGLREVGWRPQFRTQRTSRPLEESADPDKLSNA
LTGVLQSVRQHSAAWPFLKPVNPAEVPDYYDHIKYPMDLKTMGERLKNKYYISRRLFMAD
MARIFTNCRLYNSPETEYFRCANTLERYFQTKMKEIGLWDK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccattcgaaacattcggtcgaagtgaaaaccgagaagcaagatgatcgttcc
gccggaagtggaaatggtggtggaggtggcggatcacaagaggcaacccgccaggacagc
atcgagaggattttgcagcggaagcaaagggtttaccagctgccgaaaaatcagaagctg
accaagctgtcgatgtattcggcctgtcaaggaacggagtgccggtgcacgggctggaag
accccggaggagaatcgacacaaggatgtcgaagtggattactgtcccaacttcaaggag
gaatgccggaatccgaactgcaagcatcccctcgatatgcacattgcccatttgggagag
atcagcgaggaccagattaatgaactgttgggagcgatcgtcgatgtggagaatctttat
atgagtatgctgcgggagaccgacaccgacacgaagaaagtctatgcgtacctttttcgg
cttttaagacaatgcattctgacgagatctcagcccgtgatccgtggcccgctgggtgac
cctcccttcgagcaaccatccatttcgaaagcggtgacaaactttgtcctgttcaaatac
agtcatctgaatccgggcgagctggaaacgatgaccgaggtagcgaagacctttctccat
tgtttgaatcattggaattttgaagccccgagtgcgcgcaaagatctgagccatgaagat
gcttccaactacaaaatcaattacactcgctggttggtgttctgccatgttccggcattc
tgcagctccctgcgtcatttcgaaacttcaattgtgtttggccggacacttttgaaggca
gtttatcagtacgtttaccagcagctgctgaccaagtgcaaaaccgaacgggacagaatg
cccccggagaagcgtctcatgctggctcagctgcccaagtttcttgaagcgttgaagcat
gaggtcatcaacgaagaatctcaaatatgggaccagaacttcaaaccgactgcatcgttg
atgctacagaagaaacggcaacacgaagcggccacgtcctctagtgctaagaagtccaac
gacgccaagcgatacaagaaggactccgactgcgaagatcttccggacgatgtggtcatt
aaagcgctgaaaagactcaacgattccaattacaccagccgaacggaggttgtgttccct
ccgaatgccccgagagatgaagcggccaaggcggaggaaaatcgtcgggaaatcgagttc
catgtggtgggcaattcgctgaccaagccggtcaccaaggagtccatgctttggctgttg
ggtttgcacagcgtgtttgctcatcagctgccgggaatgccgagggagtacatcagtcag
ctggtgtttgatccaaaacacaaaaccctagcgctggtcaaggacggccgtccaatcggt
ggaatctgcttccgcacgttcgcaacgcaagggttcaccgagattgtgttctgtgcagtc
acgagcagcgagcaagtcaagggctacggaacccatttgatgaaccacctgaaggactac
agcacacagcgaggcatcaagcacttcctgacctacgccgacgaatttgcaatcggatat
ttcaagaagcagggtttctccaaagacattaaagtggcgcgtcatgtctatgctggttac
attaaagagtacgaaggagcaacgcttatgcattgtgaactgcatcccagcctgatttac
actcaattcagctcggtaattcggaagcagaaagagattgtaaaagagctgattgctcaa
cgtcagcaagaggttcagaaggttcatcctgggttaacgtgtttcaaagaaggcctccgt
agcattcccatcgagtccattccgggtttgcgcgaagtcggatggagaccgcagtttcgc
acccagcgcacctctcgtccactggaggaatcagccgatccggataagctgtcgaacgcc
ctgaccggtgtgctccaatccgttcggcaacattcggcagcttggccgttcttgaagccg
gtgaaccccgccgaagtgccggactactacgaccacatcaagtacccgatggacttgaaa
actatgggcgaacgactgaagaataagtattacatttcgcgacggctatttatggcagac
atggcgcgcattttcacaaactgtcgattgtataattcgcctgagactgaatactttcgt
tgcgccaacactctggagcggtatttccagaccaagatgaaggaaatcggactatgggat
aaatga

DBGET integrated database retrieval system