KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000454Help
Entry
AaeL_AAEL000454   CDS       T01053                                 

Definition
isocitrate dehydrogenase
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL000454
   01210 2-Oxocarboxylic acid metabolism
    AaeL_AAEL000454
   01230 Biosynthesis of amino acids
    AaeL_AAEL000454
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AaeL_AAEL000454
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     AaeL_AAEL000454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 396 aa AA seqDB search
MAARLIKKIFGRDPENLLKSLSQKVKDNWVKIYITSPSSREKPNKNEPIVQASTPFGARG
YASGVRKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRNPDGKFGIPQSAID
SVNRNKVGLKGPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDNVDVVTIR
ENTEGEYSGIEHEIVDGVVQSIKLITEEASNRVAEYAFKYAKDNNRKKVTVVHKANIMRM
SDGLFLRCCREMAKKYPEIKFEEKYLDTVCLNMVQDPSKFDVLVMPNLYGDIMSDMCAGL
VGGLGLTPSGNMGLNGALFESVHGTAPDIAGKDLANPTALLLSAVMMLRHMELTQHADKI
QNACFETIREAKFLTGDLGGKAKCSEYTNAICEKIH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacgtttaattaagaaaatttttggacgtgatcctgaaaatttgctcaaaagt
ttgtcacaaaaagtgaaggacaattgggtcaaaatttacataacctcgccttcctcccgt
gaaaagccaaataaaaacgagccaattgtccaagcttccactccgttcggcgcacgtggc
tatgcttccggtgtgaggaaagttacgctgatccctggggatggaattggaccagagatc
tccgctgccgttcagaagattttcaccgcggccaatgttccgatcgaatgggaggctgtc
gatgtcacacctgtcaggaatccggacggaaagtttggcattcctcaaagtgccatcgat
tcggtaaaccgcaacaaggttggcctgaaaggaccactgatgactccggtaggaaagggt
catcgctctctcaacttggctctccggaaggaattcaatctgtatgccaacgtgcgcccc
tgcagaagtctggaaggttacaaaaccttgtacgacaatgtggatgtggtcaccatccgt
gaaaacaccgagggtgagtactccggaatcgagcacgaaatcgtcgatggcgtcgtccag
agtatcaagctgatcaccgaggaggcctcgaaccgagtggccgagtatgccttcaagtac
gccaaagacaacaaccgcaagaaggtcaccgtggtccacaaggccaacattatgcgtatg
tccgatgggttgttcctgcggtgttgtcgtgagatggccaaaaaatacccggaaatcaag
ttcgaggaaaagtatctggacaccgtctgtttgaacatggttcaggacccgagcaagttt
gatgtcttggtcatgccaaatctgtacggtgacatcatgtcggatatgtgcgccggtctg
gtaggtggtctgggcttgaccccgtccggaaacatgggtctgaacggtgctctgttcgaa
tcggttcacggaaccgctcccgacatcgccggaaaggatctggctaacccaactgccctc
ctcctgtcggctgtgatgatgctgaggcacatggaactcacccagcatgcggacaagatt
cagaatgcatgcttcgaaaccatcagggaggccaaattcctgaccggtgatctgggcggc
aaggccaagtgctcagaatacaccaacgccatctgtgaaaagatccattag

DBGET integrated database retrieval system