KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000454Help
Entry
AaeL_AAEL000454   CDS       T01053                                 

Definition
isocitrate dehydrogenase
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:aag01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:aag01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aag01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aag00020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 396 aa AA seqDB search
MAARLIKKIFGRDPENLLKSLSQKVKDNWVKIYITSPSSREKPNKNEPIVQASTPFGARG
YASGVRKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRNPDGKFGIPQSAID
SVNRNKVGLKGPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDNVDVVTIR
ENTEGEYSGIEHEIVDGVVQSIKLITEEASNRVAEYAFKYAKDNNRKKVTVVHKANIMRM
SDGLFLRCCREMAKKYPEIKFEEKYLDTVCLNMVQDPSKFDVLVMPNLYGDIMSDMCAGL
VGGLGLTPSGNMGLNGALFESVHGTAPDIAGKDLANPTALLLSAVMMLRHMELTQHADKI
QNACFETIREAKFLTGDLGGKAKCSEYTNAICEKIH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacgtttaattaagaaaatttttggacgtgatcctgaaaatttgctcaaaagt
ttgtcacaaaaagtgaaggacaattgggtcaaaatttacataacctcgccttcctcccgt
gaaaagccaaataaaaacgagccaattgtccaagcttccactccgttcggcgcacgtggc
tatgcttccggtgtgaggaaagttacgctgatccctggggatggaattggaccagagatc
tccgctgccgttcagaagattttcaccgcggccaatgttccgatcgaatgggaggctgtc
gatgtcacacctgtcaggaatccggacggaaagtttggcattcctcaaagtgccatcgat
tcggtaaaccgcaacaaggttggcctgaaaggaccactgatgactccggtaggaaagggt
catcgctctctcaacttggctctccggaaggaattcaatctgtatgccaacgtgcgcccc
tgcagaagtctggaaggttacaaaaccttgtacgacaatgtggatgtggtcaccatccgt
gaaaacaccgagggtgagtactccggaatcgagcacgaaatcgtcgatggcgtcgtccag
agtatcaagctgatcaccgaggaggcctcgaaccgagtggccgagtatgccttcaagtac
gccaaagacaacaaccgcaagaaggtcaccgtggtccacaaggccaacattatgcgtatg
tccgatgggttgttcctgcggtgttgtcgtgagatggccaaaaaatacccggaaatcaag
ttcgaggaaaagtatctggacaccgtctgtttgaacatggttcaggacccgagcaagttt
gatgtcttggtcatgccaaatctgtacggtgacatcatgtcggatatgtgcgccggtctg
gtaggtggtctgggcttgaccccgtccggaaacatgggtctgaacggtgctctgttcgaa
tcggttcacggaaccgctcccgacatcgccggaaaggatctggctaacccaactgccctc
ctcctgtcggctgtgatgatgctgaggcacatggaactcacccagcatgcggacaagatt
cagaatgcatgcttcgaaaccatcagggaggccaaattcctgaccggtgatctgggcggc
aaggccaagtgctcagaatacaccaacgccatctgtgaaaagatccattag

DBGET integrated database retrieval system