KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000641Help
Entry
AaeL_AAEL000641   CDS       T01053                                 

Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AaeL_AAEL000641
Enzymes [BR:aag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AaeL_AAEL000641
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AaeL_AAEL000641
  Exosomal proteins of colorectal cancer cells
   AaeL_AAEL000641
  Exosomal proteins of bladder cancer cells
   AaeL_AAEL000641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 494 aa AA seqDB search
MRVLKSLSLVLLVAGLALVASDAEVKEEDGVLVLTKDNFQSVVEGNEFVLVEFYAPWCGH
CKALAPEYAKAAKALAEKNSNIKLGKVDATEEQELSEKHGVRGYPTLKFFRNGTPIEYTG
GREKDTIISWLEKKTGPAAKELETVAEAEEFLKEHNVAVVGFFKDRESAECKAFLATANA
VDDYPFAVTSSEDVYAKYEAKCGSIVLFKHFDDGKAVFDGEYTEEALKKFVTAQALPLIV
DFSHETAQKIFGGEIKNHLLFFISKEAGHMEKYIEAAKEVAKKYREKILFVTIDADQEDH
QRILEFFGMKKDEVPSMRIIHLEEDMAKYKPETNDLAADKVELFVSKFFEGKIKQHLLSQ
EVPEDWDKNPVKVLVADKFDEVAMDSTKDVLVEFYAPWCGHCKQLVPIYDKLGEKFADHE
SIVIAKMDATANELEHTKINSFPTIYLYRKGDNQKVEYRGERTLEGFVNFLEGKSEEPEV
EETEEDQKPEKDEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttctaaagtcgttaagtttggtgcttttggtcgccggattggctctggtggcc
tcggatgccgaagtgaaggaagaggatggcgtcctggtgctgaccaaggataacttccag
tcggtggtcgaaggcaacgaattcgtcctggttgagttctatgctccatggtgcggacac
tgcaaagccctcgcccctgaatacgccaaggccgccaaggctctggctgagaagaactcc
aacatcaagctcggcaaggtcgatgccaccgaagagcaggaactctccgaaaagcatgga
gtccgtggctacccgacgctgaaattcttccgcaatggaactcccattgagtacactggc
ggtcgcgaaaaggacaccatcatttcctggttggagaagaagactggcccagctgccaag
gaactggaaaccgttgccgaagccgaagaatttctgaaggaacacaatgtcgccgttgtc
ggtttcttcaaggaccgcgaatcggctgaatgcaaggctttcctggctactgccaatgcc
gtcgatgactatccattcgccgtgacctccagcgaagatgtgtacgccaaatacgaagcc
aagtgcggatccattgttctgttcaagcacttcgatgatggaaaggctgtcttcgatggc
gaatacaccgaggaagctctgaagaagttcgttaccgctcaggctctgccactgattgtt
gacttcagccacgaaaccgcccagaagatcttcggaggagaaatcaagaaccatctgctg
ttcttcatctcgaaggaagctggacacatggagaagtacattgaagccgccaaggaagtc
gccaagaagtaccgcgagaagatcctgttcgtcaccattgatgccgaccaagaagatcac
caacgtatcctggaattcttcggaatgaagaaggatgaggtcccatcgatgcgcatcatc
catctggaagaagatatggccaagtacaagccagaaaccaatgatttggctgctgataag
gttgagctgttcgtttccaagttcttcgaaggcaagattaagcagcacctgctgtcccag
gaagtccctgaagactgggacaagaaccccgtcaaagttctggtcgccgacaagttcgac
gaagtcgccatggactcaaccaaggatgtgctggtcgaattctacgccccatggtgcgga
cactgcaaacagctggtgccaatctacgataaactgggagagaaattcgccgatcacgag
tctatcgtgattgccaagatggatgctactgccaacgagctggagcacaccaagatcaac
tcgttcccaacgatctacctgtaccgaaagggagacaaccagaaggtcgaataccgagga
gagcgcactctggaaggattcgtcaacttcctggaaggaaagtccgaggaacccgaggtc
gaggaaaccgaagaggaccagaagccagagaaggatgagctgtaa

DBGET integrated database retrieval system