KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000693Help
Entry
AaeL_AAEL000693   CDS       T01053                                 

Definition
fkbp-rapamycin associated protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AaeL_AAEL000693
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AaeL_AAEL000693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 2444 aa AA seqDB search
MSTVVLQFVSGLKSRNKDAQNKAAQELSLYVKTELREIPQDDLLAFFEDFNQYIFEMLSS
ADINDKKGGVLAINCLISGDVVNTTTQISRYSNNLRNLLPSSDISVMELAAKVLVKLALL
PGSKGAESFEFDIKRAFEWLMEERTEGKRHAAVLVLRELAVAMPTFFYQQVGSFFEHIFV
AIKDPKPMIREGAGQALRAVLIVTSQREGTKQNNNPQWYNHCYDNAMECFRELPSREKGF
NRDDRIHGAIIVFNEILRCSNAAWEKKYMQLESLNVDRRSRHTDEGHSIFPRIRVPFMDK
LGGGHSSGASRTSEGSDVKFFRQNSSIQESAICRALTNDNYELICQKVLEQRNSKSPYVI
QSLLTILPRLAAFNRRDFVNNHLKTVVNYLILTIKSKEKERNLAFVTLGYIAVAVEKDIA
PFRTRIIEVITAALPPKETPSKKKVCVDPSVFMCITLLGHALKSAITTDVKSLILPMLST
GLSTGLTVCLHELSENVPQLRQEITSGLLKILSCVLMNKPLPQFIPGRPQGGMNTSLYEQ
QIQDTPTTVLALRTLGTFNFEGHSLLPFVQRCADHFLLSEQQEIRIEAVQTCTLLLKLAL
QSVDSADGSETLTQTVGSVLEKILIVGITDVDPNVRLRVLKSLDDSFDSQLAQPWFLSSL
LITMNDEVFEIRELAIIIIGRLSAINPAYVMPSLRKTMVQILTELEHSGMSRNKEQSARM
LDHLIVSTPRLISSYMRPILSILVPKLKEPESNPGVVLNVLRAIGDLAEVNGGHNVLEKW
SDELLATLLEMLSDAGSTEKRGVALWTLGQLVSATGQAVKPYHKYPNLIDILINFLKTEQ
QPYVRRETIRVLGLLGALDPYKHKMNRGLIDSQTNNILISISDSKTEEYTDLSTSEMLIN
MNNQLEEYYPAVAISTLMKILRDPTLSSHHTSVVQAITFIFKSLGIKCVPYLSQVLPSLL
GNIRNAEMNLKEFLFQQLSILIEIVKQHIISFMEEIFQLIKTFWNSIYPLQPTLIILVEK
IAIALGCEFKIYLPQLMPQILRVLLHDASTHRIVTVKLLNALQKFGNNLDDYLHLIIPAI
VKLFEPIEVPYQVSLAALETINYLAEILDFTDFSSRIIHPLVRVLDNHPGQLQTAALQTL
CSIMIQLGKKYLVFVPLVNRVMIRHKISYTEYNKLLSKLQSQSTLALDDEFRLRQARFKN
REMSLAGDTTIRKLNVSTADLQLAFKANRRVSRDDWLEWLRRLSIGLLKESKSPALRSCR
TLAQNYPQLLKDLFNAAFVSCWTDLPDSLKEELSSSLRQALMVPDLPEITQTILNLAEFM
EHCENDALRIDPKILGERAMECRAYAKALHYKEEEFLNMKDKDQSVFESLILINNKLQQK
EAAEGLLEYAMEHRSASEEMKVQVRWYEKLHSWEKALNLYQDKLESNPGDLDSRLGQWRC
LEALGEWSTLNTLTKETWESLGTEGQSKAGRLAAAAAWGLKDWEGMQEFVKFIPEDTQDG
SFYRAVLAVHHGEYELAQTLIDDTRDLLDTELTAMAGESYERAYGAMVCVQMLSELEEVI
QYKLIPERQETIKAMWWDRLLGGQRLVEDWQRILQVHTLVVHPANDVKTWLKFASLCRKS
DSLKLSEKTLVMLLRYNPSEYPDHPLEFMQPDISFAYAKHLWAAGEQEKAYNQLNRLVAD
MGIEGNFDVEEKDENRRLLARCYMKLGQWQNQLQGLNEQSIKGILACYEKATKHDSNWYK
AWHLWAYMNFEVVQNQKQQEDLIKNPGGDKEKCMIRQYAVPAVEGFFRSINLSHGNSLQD
TLRLLTLWFDYGQYPKVYEALVEGMRVIEINTWLQVIPQLIARIDTPRNLVGQLIHQLLN
DIGKCHPQALVYPLTVASNSASSARRQAAHKILGSMGEHSSNLVNQAIMCSEELIRVAIL
WHEQWHEGLEEASRLYFGDRNIKGMFETLEPLHQMLQRGPQTLKETSFNQAYGRDLNEAQ
EWCKHYKNSGNIRDLNQAWDLYYHVFRRISRQLPQLTSLELQYVSPKLLACRDLELAVPG
SYAPGQELIRIASIQSNLQVITSKQRPRKLCIRGSNGKEYMFLLKGHEDLRQDERVMQLF
GLVNTLLLNDPDTFRRNLTIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYREKKKTMLN
IEHRIMLRMATDYDHLTLMQKVEVFEYALELTKGDDLAKLLWLKSPSSEVWFDRRTNYTR
SLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRM
LINAMEVTGIEGTYRRTCESVMHVLRRNKDSLMAVLEAFVYDPLLNWRLLDVDKNRRSKN
ATDVDSTTESMEETLDLLINARNLRMNEANGGGDVVDQGSNCIANPAEATNNKARAIVDR
VKQKLTGKDFNTVEPVQRQIDLLIRQATNNENLCQCYIGWCPFW
NT seq 7335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggtggtgctacagttcgtgagtgggctgaaaagccgcaacaaggatgcacag
aataaggcggcccaggaactgtcgctgtacgtcaagacggaactgcgcgagattccgcag
gatgatctgctggcgttcttcgaggacttcaaccagtacattttcgagatgttgtccagt
gccgatatcaacgacaaaaagggaggcgtgctggccatcaattgcttgataagtggcgat
gtggtcaacacgacaactcagatttcccgttactcgaacaatctccggaatcttcttccg
tcgagtgacatttcggtgatggagctggcagcgaaggtgctcgtcaagttggccctcctg
cccggttccaaaggcgccgagtcgttcgagttcgacatcaaacgtgccttcgaatggctc
atggaggaacgaaccgagggcaaacgccatgcagccgttttggtgctgcgtgaactggcc
gtggccatgccgacgtttttctaccaacaggtcggaagctttttcgagcacatattcgtc
gccatcaaggatcccaaaccgatgattcgggagggcgctggccaagccttgcgggctgta
ctgattgtcacttcgcagagagagggaaccaagcagaataataatcctcaatggtacaac
cactgttacgacaatgcaatggaatgcttcagggagcttccttcccgcgagaaaggtttc
aaccgagatgatcgcatccacggagcaataattgtgttcaatgaaatcttacgatgttca
aatgcagcctgggagaaaaagtacatgcaattagaaagtttgaacgtcgatcgcaggtct
cgtcacacggatgaaggtcacagcattttcccccggattcgtgtcccgttcatggacaag
ctaggaggaggacatagctctggagcgtctcgtaccagtgagggaagtgatgtcaaattc
ttccgacagaatagctccattcaggagtctgcaatctgccgagcgttgacgaacgacaac
tacgaattgatttgtcagaaagtgcttgagcaacgcaattcaaagtcaccctacgtgatt
cagtcgctgctgaccattctacctcgattggccgccttcaatcgcagagactttgtcaat
aaccatttgaaaactgtcgtcaactatcttatcctaacgattaagagcaaagaaaaggaa
cggaatctggcgttcgtcacgcttggctatatcgccgtggcagtcgagaaggatattgcc
cccttcaggaccaggatcatcgaggtgatcacggcagctctgcctccgaaagaaacccca
agcaagaagaaagtctgcgtcgatccgtcggtgttcatgtgcatcaccctgttgggtcat
gcgttaaaaagtgcaattacaaccgatgtcaagagcttgatcctgccaatgctttcgact
ggactgagcacagggctaacggtgtgcttacacgagttgagcgagaatgtgccgcagttg
aggcaggaaattaccagcggactgttgaagattttgtcctgcgtgctgatgaataaacca
ttgccgcagtttatacccgggcggcctcaaggtggaatgaacacgagcctctacgagcaa
cagatccaagatactcccaccacagtgctggccctccgtacgctgggcaccttcaatttc
gagggtcacagcttgttgccgttcgtgcaacgatgtgccgaccatttcctgctcagcgag
cagcaggaaattcgcatcgaagccgtacagacttgtacgttgctgctaaagctagctctc
caatcggtcgattcggcagacggatcggaaaccctcacccagaccgttggaagcgtgctg
gagaagattctgatcgttggtatcaccgacgttgatccgaatgtgcgtctgagggtgctg
aaatctttggacgacagcttcgattctcagctggcgcaaccatggttcctgagctcgctg
ttgatcacgatgaatgatgaggtgtttgaaatcagggagctagcgattatcatcattgga
cgactgtcggccatcaatccggcttacgtgatgccaagcttgaggaaaacgatggtacag
atcctaacggagctggaacactccggtatgagtagaaacaaggagcagagcgcgagaatg
ttggatcatctgattgtcagcacgccgaggttgatatcttcctatatgcgtccgatcttg
tcgatcttggttccgaaattgaaagagcctgaatcgaatccgggagtggttttgaatgtg
ttaagagcgattggtgatcttgctgaagtcaatggcggccataacgttttggagaaatgg
tccgatgagctgctggctacgttgctagagatgctaagcgatgccggatcaacggaaaag
cgcggcgtagcattatggactcttggccagttggtcagtgccacggggcaagcagttaaa
ccgtaccacaaatatcccaatctgatcgatatattgatcaactttttgaaaacagaacag
caaccgtacgtaaggcgggaaacgatccgtgtcctcgggttgctcggtgccttggatccg
tacaagcacaagatgaatcgtggcctgattgacagccagaccaacaatatcctcatttcg
atttccgacagcaagactgaggaatataccgatttgtctacgtcggaaatgttgatcaat
atgaacaatcagctggaggagtactacccggcggtggccatttcaacgctgatgaagatc
cttcgtgatcctacgttatcctcgcatcacaccagcgttgtccaggcgatcacctttatc
ttcaaaagtttgggtatcaaatgcgttccgtacttgtcccaggtcttacctagtctgctc
ggcaatattcgcaatgccgaaatgaacttgaaggagttcttgttccagcagctatcgatc
ctgatcgagatagtcaaacagcacatcatcagcttcatggaggaaatattccagctgatc
aaaacgttctggaacagtatctatcctttgcagccgaccctcatcattttggtggaaaag
atcgccatcgctttgggatgtgagttcaagatctatcttcctcagttgatgccgcagatc
ttgcgagttctccttcacgatgcgtccacccatcgaatagtcaccgtcaagctcctcaac
gctctgcagaagttcgggaacaatctggacgactatcttcacttgatcattccagccatt
gttaagctgttcgaaccgatcgaagttccttaccaggtgtcccttgcagccctagaaacc
atcaactaccttgcagagatccttgatttcaccgatttctcctcgcgcatcatccatccc
ttggtacgcgtcctggacaaccacccgggtcagctccaaacggccgcgctgcaaaccctc
tgctcgatcatgatccaactgggcaagaaatacctcgtttttgtcccgctagtcaaccgg
gtcatgatcaggcacaaaatatcttacacagagtacaacaaactcctctccaagctgcaa
agtcagagtaccctcgccctggacgatgaattccgactgcgccaagctcggttcaagaat
cgcgaaatgtccctcgctggggacacgaccatccgcaagttgaacgtgtccaccgcggat
cttcagctggcgttcaaagctaatcgcagggtgtcccgtgacgattggctcgagtggctc
cgtcggctcagcattggtcttctgaaggagtccaaaagcccagcgctgcgatcctgccga
accctggcccagaactatccccaactgttgaaggatttgttcaacgcagccttcgtcagc
tgctggaccgatttaccggacagtctcaaagaggagctatcgtccagcttgaggcaggct
ctgatggtgccggaccttccggaaattacccaaaccattctcaacctggccgagtttatg
gaacactgcgagaatgatgcgctgaggatcgatccgaagatcttgggcgagagagccatg
gagtgccgagcctatgccaaggctttgcactacaaggaggaagagttcctgaacatgaag
gacaaggatcagagcgtgttcgagtcgttgattttgatcaacaataagctgcaacagaag
gaagcggctgaggggctgctggagtacgccatggaacacaggagcgcttctgaggaaatg
aaagtccaagtgaggtggtacgagaaattgcacagctgggagaaggcgttgaacttgtat
caggacaaattggagagcaatccgggtgatttggattcgcgacttggccagtggaggtgt
ttggaagcgctaggggagtggtcaacgttgaatacgctgaccaaggagacgtgggaatca
ctgggaaccgaaggacagagtaaggccggtagacttgctgccgctgcagcctggggtttg
aaggattgggagggaatgcaggagtttgtcaagttcatcccagaggacacgcaggacggg
tcgttctatcgtgccgtactggctgtgcatcacggtgagtatgaacttgcccaaacccta
attgacgatacgagagacttgttggatacggaattgaccgcgatggccggcgaatcgtac
gaacgcgcctatggagcaatggtttgcgttcaaatgctgtcggaattggaagaagtcatt
cagtacaagctgattcccgagcggcaggaaactatcaaggcaatgtggtgggatcgcttg
ctcggtggccaacgtttggtggaagattggcaacgaattttgcaggttcatactttggtt
gtccatcccgcaaatgacgtcaaaacgtggctgaagtttgcctcactttgtcgcaagagt
gattcattgaaactttccgagaagaccctcgtcatgctgcttcgctacaatccctcggag
tacccggatcatccgttggaattcatgcaaccagacatcagctttgcctacgcgaaacat
ctgtgggcagctggcgaacaagaaaaggcttacaatcaacttaatcgactagtcgccgat
atgggcatcgagggtaacttcgacgtcgaggaaaaggacgaaaaccgccgtctgttggcg
cgttgctacatgaagctcggacaatggcagaaccaactacaaggactcaacgagcaatcc
atcaagggcatcctggcatgctacgaaaaagctaccaaacacgactccaattggtacaag
gcatggcatctctgggcctacatgaactttgaagttgtccagaatcagaaacaacaggaa
gacctcatcaagaaccctggcggagacaaagagaagtgtatgattcggcagtatgccgtt
ccagcggttgaaggcttcttccgctcgatcaatctgtcacacggaaactccctccaagac
acactccgtctcctaaccctctggttcgactacggacagtatcccaaggtgtacgaagcc
ctggtcgaaggaatgcgcgtcattgaaatcaacacatggcttcaggtcatccctcagttg
atcgcccgcatcgatactccgcgcaacctagttggccaactaatccaccagctgttgaac
gacatcggaaagtgtcatccgcaggctcttgtctatccgctgaccgttgcttccaattcg
gcatccagcgcgcgacgacaggccgctcacaagatcctgggctccatgggtgaacattcg
tctaacttggtcaaccaagcgatcatgtgcagcgaggaactgatccgcgtggccattctg
tggcacgaacagtggcacgagggcttggaggaggcgtcgcggctttatttcggcgaccgg
aacatcaaaggaatgttcgaaacgttggaaccgctgcaccaaatgcttcaaaggggacct
caaaccttgaaggagacctcgttcaatcaggcgtacggtagggatctgaacgaggcgcag
gagtggtgcaaacattataagaactcgggcaacattcgtgacttgaatcaagcgtgggat
ttgtactatcacgtattccgccgaatttcccggcagttgccgcagcttacctccctagaa
ctacaatacgtcagtcctaagcttcttgcctgtcgtgatctagagctagccgtcccagga
agctacgcccccggtcaggagctgatccgaatcgccagcattcaatcgaacctccaggtg
atcacttcgaagcaaagaccgcgaaaactttgcatccgtggctccaacggcaaggagtac
atgttcctgctgaagggccacgaagatttgcgccaggacgaacgcgtgatgcagctgttt
gggctggtgaacaccctgctgctaaacgatccggacacgttccgtcggaatctgaccatt
caacggtatgcggtcattccgttgagcaccaattccggcttgatcggttgggtgccccac
tgcgatacgctgcacacgctgattcgagattaccgcgagaagaaaaagaccatgctgaac
atcgagcatcggattatgttgcgaatggcaacggattacgaccatctgacgttgatgcaa
aaggtcgaagtctttgagtatgcgttggagctcaccaaaggagacgacctggccaagctg
ctctggctgaagagcccctcgtcggaggtttggttcgatagaagaacgaattatacgcga
tcccttgcggtcatgtcgatggttggctacattctgggactgggcgatcgacatccgtcg
aacttgatgctggatcgattgagcggcaaaattctgcacatcgactttggcgattgcttc
gaggttgcgatgacccgcgagaagttcccggagaagatccccttccgtttgacgcgaatg
ctgatcaacgccatggaagttaccggcatcgagggaacctaccgccggacgtgtgaaagc
gtcatgcacgtgctccgtcgcaacaaggacagtctaatggccgtgctggaagctttcgta
tacgatccattgctcaactggcgcctgctggatgtggacaagaatcgcaggtccaagaat
gccaccgacgtggacagcacaacggaaagcatggaagaaacgttggatcttctgatcaac
gccagaaacctgcggatgaacgaagccaacggaggcggagacgtggtggatcagggcagc
aattgcatcgccaatccagccgaggctaccaacaacaaagcccgggccatcgtggatcgt
gtgaagcagaaactgaccggaaaggacttcaacacggtcgaaccggtgcaacggcagatc
gatctgttgatacggcaggcgacgaacaatgaaaacctctgccagtgctacatcgggtgg
tgtcctttctggtag

DBGET integrated database retrieval system